Basic Vector Information
- Vector Name:
- pME-EBFP2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3270 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hall TE, Currie PD.
pME-EBFP2 vector Map
pME-EBFP2 vector Sequence
LOCUS 40924_30460 3270 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pME-EBFP2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3270) AUTHORS Hall TE, Currie PD. TITLE Direct Submission JOURNAL Submitted (17-SEP-2011) Australian Regenerative Medicine Institute, Monash University, Building 75, Melbourne, VIC 3800, Australia REFERENCE 2 (bases 1 to 3270) TITLE Direct Submission REFERENCE 3 (bases 1 to 3270) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (17-SEP-2011) Australian Regenerative Medicine Institute, Monash University, Building 75, Melbourne, VIC 3800, Australia" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..3270 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 569..668 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" CDS 674..1390 /codon_start=1 /label=EBFP2 /note="enhanced blue variant of GFP (Ai et al., 2007)" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTL KFICTTGKLPVPWPTLVTTLSHGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GTYKTRAEVKFEGDTLVNRIELKGVDFKEDGNILGHKLEYNFNSHNIYIMAVKQKNGIK VNFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSVLSKDPNEKRDHMVLL EFRTAAGITLGMDELYK" protein_bind complement(1395..1494) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(1512..1530) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(1535..1551) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 1664..2470 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2620..3208 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.