pMD-TV vector (V004803)

LOCUS       V004803                 6155 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004803
VERSION     V004803
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6155)
  AUTHORS   Dharmasena MN, Hanisch BW, Wai TT, Kopecko DJ.
  TITLE     Stable expression of Shigella sonnei form I O-polysaccharide genes
            recombineered into the chromosome of live Salmonella oral vaccine
            vector Ty21a
  JOURNAL   Int. J. Med. Microbiol. 303 (3), 105-113 (2013)
   PUBMED   23474241
REFERENCE   2  (bases 1 to 6155)
  AUTHORS   Dharmasena MN, Hanisch BW, Wai TT, Kopecko DJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUL-2012) Laboratory of Enteric and Sexually
            Transmitted Diseases, FDA-CBER, Lincoln Drive, Bethesda, MD 20892,
            USA
REFERENCE   3  (bases 1 to 6155)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6155)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Vertor NTI v. NTI
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Int. J.
            Med. Microbiol."; date: "2013"; volume: "303"; issue: "3"; pages:
            "105-113"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (30-JUL-2012) Laboratory of Enteric and Sexually Transmitted
            Diseases, FDA-CBER, Lincoln Drive, Bethesda, MD 20892, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6155
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             109..1173
                     /gene="vexA"
                     /label="Vi polysaccharide export protein VexA/TviF"
                     /note="Vi polysaccharide export protein VexA/TviF from
                     Salmonella typhi. Accession#: Q04976"
     rep_origin      1658..1880
                     /label="pSC101 ori"
                     /note="low-copy replication origin that requires the Rep101
                     protein"
     CDS             1928..2875
                     /label="Rep101"
                     /note="RepA protein needed for replication with the pSC101
                     origin"
     gene            3914..4420
                     /gene="tivD"
                     /label="tivD"
     CDS             3914..4417
                     /codon_start=1
                     /gene="tivD"
                     /product="TivD"
                     /label="tivD"
                     /protein_id="AGH89392.1"
                     /translation="PFLIDLIANVMSITLSFQNASMNKLFEKECRNVATRALKYVRQKK
                     TEGRLDEALSVLISLKRIEPDVSRLMREYKQIIRLFNESRKDGGSTITSYEHLDYAKKL
                     LVFDSENAYALKYAALNAMHLRDYTQALQYWQRLEKVNGPTEPVTRQISTCITALQKNT
                     SGKS"
     protein_bind    complement(4444..4491)
                     /label="FRT"
                     /bound_moiety="FLP recombinase from the Saccharomyces
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     CDS             4852..5643
                     /label="NeoR/KanR"
                     /note="aminoglycoside phosphotransferase"
     protein_bind    complement(5837..5870)
                     /label="FRT (minimal)"
                     /note="supports FLP-mediated excision but not integration
                     (Turan and Bode, 2011)"