Basic Vector Information
- Vector Name:
- pMCS
- Antibiotic Resistance:
- Kanamycin
- Length:
- 12362 bp
- Type:
- Standard reference vector
- Replication origin:
- ori
- Source/Author:
- Xi J, Wang X, Dong L, Dong Y, Su Y, Tang Q, Wang Z.
- Promoter:
- CaMV35S(enhanced)
pMCS vector Map
pMCS vector Sequence
LOCUS V004804 12362 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004804 VERSION V004804 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 12362) AUTHORS Xi J, Wang X, Dong L, Dong Y, Su Y, Tang Q, Wang Z. TITLE Construction of a standard reference plasmid containing seven target genes for the detection of transgenic cotton JOURNAL Unpublished REFERENCE 2 (bases 1 to 12362) AUTHORS Xi J, Wang X, Dong L, Dong Y, Su Y, Tang Q, Wang Z. TITLE Direct Submission JOURNAL Submitted (14-APR-2014) Biosafet Lab, Biotechnology Research Institute, No. 12 Zhongguancun South Street, Beijing 100081, China REFERENCE 3 (bases 1 to 12362) TITLE Direct Submission REFERENCE 4 (bases 1 to 12362) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-APR-2014) Biosafet Lab, Biotechnology Research Institute, No. 12 Zhongguancun South Street, Beijing 100081, China" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..12362 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1219..1845 /label="pVS1 StaA" /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS 2282..3346 /label="pVS1 RepA" /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 3415..3609 /label="pVS1 oriV" /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 3953..4093 /label="bom" /note="basis of mobility region from pBR322" rep_origin complement(4279..4867) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4957..5748) /label="KanR" /note="aminoglycoside phosphotransferase" misc_feature 6173..6197 /label="LB T-DNA repeat" /note="left border repeat from nopaline C58 T-DNA" polyA_signal complement(6275..6449) /label="CaMV poly(A) signal" /note="cauliflower mosaic virus polyadenylation signal" CDS complement(6509..7297) /label="NeoR/KanR" /note="aminoglycoside phosphotransferase" promoter complement(7366..8043) /label="CaMV 35S promoter (enhanced)" /note="cauliflower mosaic virus 35S promoter with a duplicated enhancer region" protein_bind 8234..8255 /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." promoter 8270..8300 /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind 8308..8324 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 8332..8348 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" CDS 8364..8633 /codon_start=1 /gene="cptI" /product="cowpea trypsin inhibitor" /label="cptI" /protein_id="AII71483.1" /translation="MRMDLKHLGSNHHDDSSDEPSESSEPCCDSCICTKSIPPQCHCTD IRWNSCHSACKSCMCTRSMPGKCRCLDIADFCYKPCKSRDEDDE" gene 8364..8633 /gene="cptI" /label="cptI" CDS complement(8551..9579) /codon_start=1 /gene="Cry1Ab/1Ac" /product="Cry1Ab/Cry1Ac fusion protein" /label="Cry1Ab/1Ac" /note="Bt protein" /protein_id="AII71484.1" /translation="NCLSNPEVVVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVL GPVDIIWGIFGPSQWDAFLVQIEQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREW EADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSVYVQAANLHLSVLRDVS VFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRE LTLTVLDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSP HLMDILNSITIYTDAHRGEYYWSGHQIMASPVGFIIRRLRHEICTVCSRSPRCPGNGIY PA" gene complement(8551..9579) /gene="Cry1Ab/1Ac" /label="Cry1Ab/1Ac" CDS 9595..10959 /gene="aroA" /label="3-phosphoshikimate 1-carboxyvinyltransferase" /note="3-phosphoshikimate 1-carboxyvinyltransferase from Agrobacterium sp. (strain CP4). Accession#: Q9R4E4" regulatory 10963..11180 /label="NOS" /note="NOS" /regulatory_class="terminator" CDS join(11182..11296,11671..12064) /codon_start=1 /gene="SadI" /product="AE9 stearoyl-ACP desaturase" /label="SadI" /note="from cotton K312" /protein_id="AII71486.1" /translation="STMPSPRNLRSSLALLFHQRPPLDLPSFP*SPPFLLAPKRLGI*K SLSRLQRRCLFRSPTPCRLTRLRSLNLWRAGLRTTF*LTSNQLRNVGNPPTFFQILILM DFMSKSKSLGKGQRRSQMITL*FWLVI*SPRKPFQLIKQCLIPWMELVMRQVLASLALA VVLQRR" gene 11182..12064 /gene="SadI" /label="SadI" primer_bind complement(12038..12054) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" misc_feature 12257..12281 /label="RB T-DNA repeat" /note="right border repeat from nopaline C58 T-DNA"
This page is informational only.