pMCI002 vector (V004805)

LOCUS       V004805                 3990 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004805
VERSION     V004805
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 3990)
  AUTHORS   Uhlich GA, Chen CY.
  TITLE     A cloning vector for creation of Escherichia colilacZ translational
            fusions and generation of linear template for chromosomal
            integration
  JOURNAL   Plasmid 67 (3), 259-263 (2012)
   PUBMED   22197962
REFERENCE   2  (bases 1 to 3990)
  AUTHORS   Chen C-Y., Uhlich GA.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-SEP-2011) Molecular Characterization of Foodborne
            Pathogens RU, US Department of Agriculture, 600 E. Mermaid Lane,
            Wyndmoor, PA 19038, USA
REFERENCE   3  (bases 1 to 3990)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3990)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid";
            date: "2012"; volume: "67"; issue: "3"; pages: "259-263"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (26-SEP-2011) Molecular Characterization of Foodborne Pathogens RU,
            US Department of Agriculture, 600 E. Mermaid Lane, Wyndmoor, PA
            19038, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3990
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     1..21
                     /label="LacIF primer binding site"
                     /note="LacIF primer binding site"
     primer_bind     51..76
                     /note="SpecF primer binding site; primer with additional
                     sequence at the 5' end 'AAGGAATT'"
     CDS             228..1007
                     /gene="ant1"
                     /label="Spectinomycin 9-adenylyltransferase"
                     /note="Spectinomycin 9-adenylyltransferase from
                     Staphylococcus aureus (strain N315). Accession#: P0A0D1"
     primer_bind     complement(1257..1294)
                     /label="SpecR primer binding site"
                     /note="SpecR primer binding site"
     misc_feature    1279..1302
                     /label="multiple cloning site"
                     /note="multiple cloning site"
     CDS             1298..1408
                     /codon_start=1
                     /product="lacZ"
                     /label="lacZ"
                     /note="lacZ reading frame for translational fusion"
                     /protein_id="AFA52512.1"
                     /translation="DPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR"
     primer_bind     complement(1346..1367)
                     /label="LacZR primer binding site"
                     /note="LacZR primer binding site"
     primer_bind     complement(1389..1409)
                     /label="LacZR2 primer binding site"
                     /note="LacZR2 primer binding site"
     rep_origin      complement(1418..1806)
                     /direction=LEFT
                     /label="R6K gamma ori"
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     CDS             complement(1836..2393)
                     /codon_start=1
                     /gene="traI"
                     /product="TraI"
                     /label="traI"
                     /note="TraI DNA relaxase"
                     /protein_id="AFA52510.1"
                     /translation="MIAKHVPMRSIKKSDFAELVKYITDEQGKTERLGHVRVTNCEANT
                     LPAVMAEVMATQHGNTRSEADKTYHLLVSFRAGEKPDAETLRAIEDRICAGLGFAEHQR
                     VSAVHHDTDNLHIHIAINKIHPTRNTIHEPYRAYRALADLCATLERDYGLERDNHETRQ
                     RVSENRANDMERHAGVESLVGWI"
     gene            complement(1836..2393)
                     /gene="traI"
                     /label="traI"
     CDS             complement(2431..2799)
                     /label="traJ"
                     /note="oriT-recognizing protein"
     oriT            complement(2832..2941)
                     /direction=LEFT
                     /label="oriT"
                     /note="incP origin of transfer"
     CDS             3167..3563
                     /codon_start=1
                     /gene="traK"
                     /product="TraK"
                     /label="traK"
                     /note="oriT binding protein"
                     /protein_id="AFA52508.1"
                     /translation="MPKSYTDELAEWVESRAAKKRRRDEAAVAFLAVRADVEAALASGY
                     ALVTIWEHMRETGKVKFSYETFRSHARRHIKAKPADVPAPQAKAAEPAPAPKTPEPRRP
                     KQGGKAEKPAPAAAPTGFTFNPTPDKKD"
     gene            3167..3563
                     /gene="traK"
                     /label="traK"
     promoter        3670..3772
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"