Basic Vector Information
- Vector Name:
- pMCG16-S
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4227 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Krieg AM, Wu T, Weeratna R, Efler SM, Love-Homan L, Yang L, Yi AK, Short D, Davis HL.
pMCG16-S vector Map
pMCG16-S vector Sequence
LOCUS 40924_29961 4227 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pMCG16-S, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4227) AUTHORS Krieg AM, Wu T, Weeratna R, Efler SM, Love-Homan L, Yang L, Yi AK, Short D, Davis HL. TITLE Sequence motifs in adenoviral DNA block immune activation by stimulatory CpG motifs JOURNAL Proc. Natl. Acad. Sci. U.S.A. 95 (21), 12631-12636 (1998) PUBMED 9770537 REFERENCE 2 (bases 1 to 4227) AUTHORS Wu T, Efler SM, Davis HL, Krieg AM, Schorr J. TITLE Direct Submission JOURNAL Submitted (12-MAR-1998) HGD, Loeb Health Research Institute, 725 Parkdale Ave., Ottawa, ON K1Y 4E9, Canada REFERENCE 3 (bases 1 to 4227) TITLE Direct Submission REFERENCE 4 (bases 1 to 4227) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "1998"; volume: "95"; issue: "21"; pages: "12631-12636" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-MAR-1998) HGD, Loeb Health Research Institute, 725 Parkdale Ave., Ottawa, ON K1Y 4E9, Canada" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4227 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal 77..284 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" primer_bind complement(312..328) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(336..352) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." protein_bind complement(407..428) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(716..1304) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1450..2256) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" primer_bind 2772..2788 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 2795..2813 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(2828..2844) /label=SK primer /note="common sequencing primer, one of multiple similar variants" enhancer 2873..3252 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 3253..3456 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 3528..4205 /codon_start=1 /label=HBsAg (S) /note="major/small (S) envelope protein of hepatitis B virus" /translation="MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGML PVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLW EWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCL WVYI"
This page is informational only.