Basic Vector Information
- Vector Name:
- pMC212
- Antibiotic Resistance:
- Kanamycin
- Length:
- 13012 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Host:
- Yeast
- Source/Author:
- Currie DH, Herring CD, Guss AM, Olson DG, Hogsett DA, Lynd LR.
- Promoter:
- URA3
pMC212 vector Vector Map
pMC212 vector Sequence
LOCUS V004810 13012 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004810 VERSION V004810 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 13012) AUTHORS Currie DH, Herring CD, Guss AM, Olson DG, Hogsett DA, Lynd LR. TITLE Functional heterologous expression of an engineered full length CipA from Clostridium thermocellum in Thermoanaerobacterium saccharolyticum JOURNAL Biotechnol Biofuels 6 (1), 32 (2013) PUBMED 23448319 REFERENCE 2 (bases 1 to 13012) AUTHORS Currie DH, Herring CD, Guss AM, Olson DG, Hogsett DA, Lynd LR. TITLE Direct Submission JOURNAL Submitted (22-FEB-2013) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 13012) TITLE Direct Submission REFERENCE 4 (bases 1 to 13012) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol Biofuels"; date: "2013"; volume: "6"; issue: "1"; pages: "32" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-FEB-2013) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..13012 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..1500 /label="similar to xynA upstream region" /note="similar to xynA upstream region" CDS 1501..3723 /gene="celS" /label="Cellulose 1,4-beta-cellobiosidase (reducing end) CelS" /note="Cellulose 1,4-beta-cellobiosidase (reducing end) CelS from Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372). Accession#: A3DH67" CDS 3739..3765 /label="9xHis" /note="9xHis affinity tag" CDS 3966..4952 /codon_start=1 /product="pta" /label="pta" /protein_id="AGG53972.1" /translation="MSIIQNIIEKAKSDKKKIVLPEGAEPRTLKAAEIVLKEGIADLVL LGNEDEIRNAAKDLDISKAEIIDPVKSEMFDRYANDFYELRKNKGITLEKARETIKDNI YFGCMMVKEGYADGLVSGAIHATADLLRPAFQIIKTAPGAKIVSSFFIMEVPNCEYGEN GVFLFADCAVNPSPNAEELASIAVQSANTAKNLLGFEPKVAMLSFSTKGSASHELVDKV RKATEIAKELMPDVAIDGELQLDAALVKEVAELKAPGSKVAGCANVLIFPDLQAGNIGY KLVQRLAKANAIGPITQGMGAPVNDLSRGCSYRDIVDVIATTAVQAQ" CDS 4970..6181 /codon_start=1 /product="ack" /label="ack" /protein_id="AGG53973.1" /translation="MKIMKILVINCGSSSLKYQLIESTDGNVLAKGLAERIGINDSMLT HNANGEKIKIKKDMKDHKDAIKLVLDALVNSDYGVIKDMSEIDAVGHRVVHGGESFTSS VLINDEVLKAITDCIELAPLHNPANIEGIKACQQIMPNVPMVAVFDTAFHQTMPDYAYL YPIPYEYYTKYRIRRYGFHGTSHKYVSNRAAEILNKPIEDLKIITCHLGNGSSIAAVKY GKSIDTSMGFTPLEGLAMGTRSGSIDPSIISYLMEKENISAEEVVNILNKKSGVYGISG ISSDFRDLEDAAFKNGDERAQLALNVFAYRVKKTIGAYAAAMGGVDVIVFTAGVGENGP EIREFILDGLEFLGFSLDKEKNKVRGKETIISTPNSKVSVMVVPTNEEYMIAKDTEKIV KSIK" CDS 6840..7631 /label="KanR" /note="aminoglycoside phosphotransferase" misc_feature 7780..9217 /label="similar to xynA downstream region" /note="similar to xynA downstream region" rep_origin complement(9556..10101) /direction=LEFT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 10213..10241 /label="tet promoter" /note="E. coli promoter for tetracycline efflux protein gene" CDS complement(10318..11118) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(11119..11339) /label="URA3 promoter" misc_feature 11367..11870 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" oriT complement(12269..12378) /direction=LEFT /label="oriT" /note="incP origin of transfer" terminator complement(12799..12826) /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(12918..13004) /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.