Basic Vector Information
- Vector Name:
- pMC200
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10782 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Host:
- Yeast
- Source/Author:
- Currie DH, Herring CD, Guss AM, Olson DG, Hogsett DA, Lynd LR.
- Promoter:
- URA3
pMC200 vector Map
pMC200 vector Sequence
LOCUS 40924_29921 10782 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMC200, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10782) AUTHORS Currie DH, Herring CD, Guss AM, Olson DG, Hogsett DA, Lynd LR. TITLE Functional heterologous expression of an engineered full length CipA from Clostridium thermocellum in Thermoanaerobacterium saccharolyticum JOURNAL Biotechnol Biofuels 6 (1), 32 (2013) PUBMED 23448319 REFERENCE 2 (bases 1 to 10782) AUTHORS Currie DH, Herring CD, Guss AM, Olson DG, Hogsett DA, Lynd LR. TITLE Direct Submission JOURNAL Submitted (22-FEB-2013) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 10782) TITLE Direct Submission REFERENCE 4 (bases 1 to 10782) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol Biofuels"; date: "2013"; volume: "6"; issue: "1"; pages: "32" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-FEB-2013) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10782 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..1500 /label=similar to xynA upstream region /note="similar to xynA upstream region" misc_feature 1501..1541 /label=restriction cassette /note="restriction cassette" CDS 1736..2722 /codon_start=1 /product="pta" /label=pta /protein_id="AGG53967.1" /translation="MSIIQNIIEKAKSDKKKIVLPEGAEPRTLKAAEIVLKEGIADLVL LGNEDEIRNAAKDLDISKAEIIDPVKSEMFDRYANDFYELRKNKGITLEKARETIKDNI YFGCMMVKEGYADGLVSGAIHATADLLRPAFQIIKTAPGAKIVSSFFIMEVPNCEYGEN GVFLFADCAVNPSPNAEELASIAVQSANTAKNLLGFEPKVAMLSFSTKGSASHELVDKV RKATEIAKELMPDVAIDGELQLDAALVKEVAELKAPGSKVAGCANVLIFPDLQAGNIGY KLVQRLAKANAIGPITQGMGAPVNDLSRGCSYRDIVDVIATTAVQAQ" CDS 2740..3951 /codon_start=1 /product="ack" /label=ack /protein_id="AGG53968.1" /translation="MKIMKILVINCGSSSLKYQLIESTDGNVLAKGLAERIGINDSMLT HNANGEKIKIKKDMKDHKDAIKLVLDALVNSDYGVIKDMSEIDAVGHRVVHGGESFTSS VLINDEVLKAITDCIELAPLHNPANIEGIKACQQIMPNVPMVAVFDTAFHQTMPDYAYL YPIPYEYYTKYRIRRYGFHGTSHKYVSNRAAEILNKPIEDLKIITCHLGNGSSIAAVKY GKSIDTSMGFTPLEGLAMGTRSGSIDPSIISYLMEKENISAEEVVNILNKKSGVYGISG ISSDFRDLEDAAFKNGDERAQLALNVFAYRVKKTIGAYAAAMGGVDVIVFTAGVGENGP EIREFILDGLEFLGFSLDKEKNKVRGKETIISTPNSKVSVMVVPTNEEYMIAKDTEKIV KSIK" CDS 4610..5401 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" misc_feature 5550..6987 /label=similar to xynA downstream region /note="similar to xynA downstream region" rep_origin complement(7326..7871) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 7983..8011 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS complement(8088..8888) /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" promoter complement(8889..9109) /label=URA3 promoter misc_feature 9137..9640 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" oriT complement(10039..10148) /direction=LEFT /label=oriT /note="incP origin of transfer" terminator complement(10569..10596) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(10688..10774) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.