Basic Vector Information
- Vector Name:
- pMB-7
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6592 bp
- Type:
- Yeast expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pMB-7 vector Vector Map
pMB-7 vector Sequence
LOCUS V004824 6592 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004824 VERSION V004824 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6592) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6592) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6592) TITLE Direct Submission REFERENCE 4 (bases 1 to 6592) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6592 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS complement(625..1500) /codon_start=1 /note="unnamed protein product; Salmonella hisG" /protein_id="SJL88114.1" /translation="MLDNTRLRIAIQKSGRLSDDSRELLARCGIKINLHTQRLIAMAEN MPIDILRVRDDDIPGLVMDGVVDLGIIGENVLEEELLNRRAQGEDPRYLTLRRLDFGGC RLSLATPVDEAWDGPAALDGKRIATSYPHLLKRYLDQKGVSFKSCLLNGSVEVAPRAGL ADAICDLVSTGATLEANGLREVEVIYRSKACLIQRDGEMAQSKQELIDKLLTRIQGVIQ ARESKYIMMHAPSERLEEVIALLPGAERPTILPLAGEQQRVAMHMVSSETLFWETMDPR DNRVIDPWRN" CDS complement(2092..2901) /gene="URA3" /label="Orotidine 5'-phosphate decarboxylase" /note="Orotidine 5'-phosphate decarboxylase from Candida albicans (strain SC5314 / ATCC MYA-2876). Accession#: P13649" CDS complement(3370..4227) /codon_start=1 /note="unnamed protein product; Salmonella hisG" /protein_id="SJL88116.1" /translation="MLDNTRLRIAIQKSGRLSDDSRELLARCGIKINLHTQRLIAMAEN MPIDILRVRDDDIPGLVMDGVVDLGIIGENVLEEELLNRRAQGEDPRYLTLRRLDFGGC RLSLATPVDEAWDGPAALDGKRIATSYPHLLKRYLDQKGVSFKSCLLNGSVEVAPRAGL ADAICDLVSTGATLEANGLREVEVIYRSKACLIQRDGEMAQSKQELIDKLLTRIQGVIQ ARESKYIMMHAPSERLEEVIALLPGAERPTILPLAGEQQRVAMHMVSSETLFWETMDPL PCYP" primer_bind complement(4371..4387) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4395..4411) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4419..4449) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(4464..4485) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4773..5361) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5535..6392) /label="AmpR" /note="beta-lactamase" promoter complement(6393..6497) /label="AmpR promoter"
This page is informational only.