Basic Vector Information
- Vector Name:
- pMaTc
- Antibiotic Resistance:
- Tetracycline
- Length:
- 5214 bp
- Type:
- Mariner mini-transposon delivery vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Krol JE, Rogers LM, Krone SM, Top EM.
pMaTc vector Vector Map
pMaTc vector Sequence
LOCUS 40924_29836 5214 bp DNA circular SYN 18-DEC-2018 DEFINITION Mariner mini-transposon delivery vector pMaTc, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5214) AUTHORS Krol JE, Rogers LM, Krone SM, Top EM. TITLE Dual reporter system for in situ detection of plasmid transfer under aerobic and anaerobic conditions JOURNAL Appl. Environ. Microbiol. 76 (13), 4553-4556 (2010) PUBMED 20453134 REFERENCE 2 (bases 1 to 5214) AUTHORS Krol JE. TITLE Direct Submission JOURNAL Submitted (31-MAR-2010) Biological Sciences, University of Idaho, P.O. Box 445031, Moscow, ID 83844, USA REFERENCE 3 (bases 1 to 5214) TITLE Direct Submission REFERENCE 4 (bases 1 to 5214) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2010"; volume: "76"; issue: "13"; pages: "4553-4556" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-MAR-2010) Biological Sciences, University of Idaho, P.O. Box 445031, Moscow, ID 83844, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5214 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 34..402 /codon_start=1 /label=traJ /note="oriT-recognizing protein" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" rep_origin 1021..1409 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" repeat_region 1451..1478 /label=mariner end /note="mariner end" CDS 1647..2843 /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="VKPNRPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHY GILLALYALMQFACAPVLGALSDRFGRRPVLLVSLAGAAVDYAIMATAPFLWVLYIGRI VAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPHAPF FAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIM QLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQAMITGPVAARLGERRALM LGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQLQGSL AALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSGAGQRADR " repeat_region 2992..3019 /label=mariner end /note="mariner end" primer_bind 3152..3168 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3178..3196 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS complement(3259..4305) /codon_start=1 /gene="tnpA" /product="TnpA" /label=tnpA /note="mariner transposase" /protein_id="ADJ00065.1" /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH IIHQYLDMRKLCAKWVPRELTFDQKQRRVDDSKRCLQLLTRNTPEFFRRYVTMDETWLH HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSP DLAPSDFFLFSDLKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCI ALEGNYVE" gene complement(3259..4305) /gene="tnpA" /label=tnpA oriT 5106..5214 /label=oriT /note="incP origin of transfer"
This page is informational only.