Basic Vector Information
- Vector Name:
- pLZ42
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3890 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Zhou L, Zhang K, Wanner BL.
pLZ42 vector Map
pLZ42 vector Sequence
LOCUS 40924_29556 3890 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLZ42, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3890) AUTHORS Zhou L, Zhang K, Wanner BL. TITLE Chromosomal expression of foreign and native genes from regulatable promoters in Escherichia coli JOURNAL Methods Mol. Biol. 267, 123-134 (2004) PUBMED 15269420 REFERENCE 2 (bases 1 to 3890) AUTHORS Zhou L, Zhang K, Wanner BL. TITLE Direct Submission JOURNAL Submitted (13-FEB-2003) Biological Sciences, Purdue University, Lilly Hall, West Lafayette, IN 47907, USA REFERENCE 3 (bases 1 to 3890) TITLE Direct Submission REFERENCE 4 (bases 1 to 3890) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Methods Mol. Biol. 267, 123-134 (2004)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-FEB-2003) Biological Sciences, Purdue University, Lilly Hall, West Lafayette, IN 47907, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3890 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 50..136 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 228..255 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" protein_bind complement(357..376) /label=lac operator (symmetric) /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." promoter 391..421 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" protein_bind 429..445 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter 475..579 /label=AmpR promoter CDS 580..1437 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" terminator 1531..1777 /label=lambda tL3 terminator /note="transcription terminator tL3 from phage lambda" protein_bind 1791..2108 /label=phage Phi-80 attP /note="attachment site of phage phi-80" rep_origin complement(2219..2607) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(2758..3414) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPKFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(3415..3517) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" misc_feature 3714..3890 /label=oriT2 /note="oriT2"
This page is informational only.