Basic Vector Information
- Vector Name:
- pLX-TCTV
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7625 bp
- Type:
- Binary vector
- Replication origin:
- pBBR1 oriV
- Host:
- Plants
- Source/Author:
- Pasin F, Tseng XA, Bedoya LC, Heydarnejad J, Deng TC, Garcia JA, Chen YR.
- Promoter:
- CaMV 35S (enhanced)
pLX-TCTV vector Map
pLX-TCTV vector Sequence
LOCUS 40924_29426 7625 bp DNA circular SYN 18-DEC-2018 DEFINITION Binary vector pLX-TCTV, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7625) AUTHORS Pasin F, Tseng XA, Bedoya LC, Heydarnejad J, Deng TC, Garcia JA, Chen YR. TITLE Streamlined generation of plant virus infectious clones using the pLX mini binary vectors JOURNAL J. Virol. Methods (2018) In press PUBMED 30236898 REFERENCE 2 (bases 1 to 7625) AUTHORS Pasin F. TITLE Direct Submission JOURNAL Submitted (11-APR-2018) Agricultural Biotechnology Research Center, Academia Sinica, 128 Academia Road, Section 2, Nangang District, Taipei, Taipei 11529, Taiwan REFERENCE 3 (bases 1 to 7625) TITLE Direct Submission REFERENCE 4 (bases 1 to 7625) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Virol. Methods (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-APR-2018) Agricultural Biotechnology Research Center, Academia Sinica, 128 Academia Road, Section 2, Nangang District, Taipei, Taipei 11529, Taiwan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: UltraCycler v. v1.0 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7625 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 25..72 /label=bacterial terminator /note="bacterial terminator" /regulatory_class="terminator" misc_feature 133..157 /label=LB T-DNA repeat /note="left border repeat from octopine Ach5 T-DNA" misc_feature 184..208 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" promoter 535..1203 /label=CaMV 35S promoter (enhanced) /note="cauliflower mosaic virus 35S promoter with a duplicated enhancer region" misc_feature 1204..4671 /note="Turnip curly top virus isolate IR:Zaf:B11:06 (1.16x); GU456685" CDS 1578..2693 /codon_start=1 /product="Rep" /label=Rep /protein_id="AYC81460.1" /translation="MPRTPRQYRIHAKNIFLTYPHCHLTKEDALLQLQTIQCPSTKKFI RICRERHDNGEPHLHVLIQFEGKIQLYNPRHFDLRDGGSGRICHPNIQGAKSSSDVKSY IEKDGDYIDWGEFQIDARSARGGQQTANDACAEALNSGTAEAALAVIREKLPKDYIFQF HNLKPNLAAIFNPPPVGYVPKYNHTQFVLTDDILDWLESNFFLEESNSPAGPSKYKVIP SIDRPKSIIIEGPSRTGKTLWARSLGSHNYITGHLDFSTKVYNDDVSYNVIDDVDPHYL KMKHWKHLIGAQKEWQTNLKYGKPRIIKGGIPSIILCNPGDGASYQNFLDKPENEALKS WSLQNSVFTTIEEPLFNITSDQEVEDSTPTV" CDS 1738..1995 /codon_start=1 /product="C4" /label=C4 /protein_id="AYC81461.1" /translation="MGNLISMCLSNSKEKSSSITPVISIYEMEVPVASATQIFRELNRA PTSSPISRRTEITSTGVNFRSMHDLHEEVNRRLMMHVQRR" CDS 2581..3006 /codon_start=1 /product="C2" /label=C2 /protein_id="AYC81462.1" /translation="MKPLSPGVYKIQSSQQSRNLSSISRVIKKSKTVLLPCKCKFTIHH ECGEGFTHRGTHNSSSINDWNIHTSSTKPVSSQTNIMGPPGERVLQHQITTPIQLQPTE TTGITHGLDRIHGIGSSPEFDWTSIYDDFFEEITLLP" CDS 2714..3136 /codon_start=1 /product="C3" /label=C3 /protein_id="AYC81463.1" /translation="MSVVRDLRTGEPITHRQSTIGTYIHQVPNPFHLKLISWDHQENGF FNIRLQLRFNYNLRKQLGLHMAWIEFTVLGRHRSLTGHRFTTIFLKRLLFYLNNLGIIS LNLVINGISHVLFKDFKFVESVINQEYRVAMKEEFY" CDS complement(3133..3963) /codon_start=1 /product="coat protein" /label=coat protein /protein_id="AYC81464.1" /translation="MSGTWSLKRPRWHSPGYDLAPKTPVKRPAVRRALFNNQAQFSRVA ARRRWSKFPVRGNKPYRYRKLKASDYQIYKDKIGGDNGWTVTFSGDCTMLNNYVRGIGR DQRDSVMTKTAHMHFNGVLMANDAFWEAPNYMTMYSWIILDNDPGGTFPKPSDIFDMEY KEFPSMYEVAESVKSRFIVKRKTEHYLRSTGVAFGEKQNYKAPNVGPVKKPIRMKFRNI WQPSEWKDTAGGKYEDLKKGALLYVCICDNKATQFSFNLKGQWTMYFINRDLMY" CDS complement(3818..4195) /codon_start=1 /product="V2" /label=V2 /protein_id="AYC81465.1" /translation="MIWRIAKDDKRVRAFRYKKRRFYSLSEYLLAPLATHLRLARILPE KCWSVVPAYTDEAYSFLFMLKEETRTPFQILKDEWNVEFKEAEVALSRLRLSTEDTGEE TGGEESPVQQSSPVQSSSCET" terminator 4674..4926 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" misc_feature 4991..5014 /label=RB /note="RB" regulatory 5079..5119 /label=bacterial terminator /note="bacterial terminator" /regulatory_class="terminator" CDS complement(5166..5978) /label=KanR /note="aminoglycoside phosphotransferase" CDS complement(6107..6766) /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" rep_origin complement(6767..7538) /direction=LEFT /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication"
This page is informational only.