Basic Vector Information
- Vector Name:
- pLX-CaMV
- Antibiotic Resistance:
- Kanamycin
- Length:
- 12857 bp
- Type:
- Binary vector
- Replication origin:
- pBBR1 oriV
- Host:
- Plants
- Source/Author:
- Pasin F, Tseng XA, Bedoya LC, Heydarnejad J, Deng TC, Garcia JA, Chen YR.
- Promoter:
- CaMV 35S (enhanced)
pLX-CaMV vector Map
pLX-CaMV vector Sequence
LOCUS V004886 12857 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004886 VERSION V004886 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 12857) AUTHORS Pasin F, Tseng XA, Bedoya LC, Heydarnejad J, Deng TC, Garcia JA, Chen YR. TITLE Streamlined generation of plant virus infectious clones using the pLX mini binary vectors JOURNAL J. Virol. Methods (2018) In press PUBMED 30236898 REFERENCE 2 (bases 1 to 12857) AUTHORS Pasin F. TITLE Direct Submission JOURNAL Submitted (11-APR-2018) Agricultural Biotechnology Research Center, Academia Sinica, 128 Academia Road, Section 2, Nangang District, Taipei, Taipei 11529, Taiwan REFERENCE 3 (bases 1 to 12857) TITLE Direct Submission REFERENCE 4 (bases 1 to 12857) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: UltraCycler v. v1.0 Sequencing Technology :: Illumina ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "J. Virol. Methods (2018) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-APR-2018) Agricultural Biotechnology Research Center, Academia Sinica, 128 Academia Road, Section 2, Nangang District, Taipei, Taipei 11529, Taiwan" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..12857 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 25..72 /label="bacterial terminator" /note="bacterial terminator" /regulatory_class="terminator" misc_feature 133..157 /label="LB T-DNA repeat" /note="left border repeat from octopine Ach5 T-DNA" misc_feature 184..208 /label="LB T-DNA repeat" /note="left border repeat from nopaline C58 T-DNA" promoter 535..1212 /label="CaMV 35S promoter (enhanced)" /note="cauliflower mosaic virus 35S promoter with a duplicated enhancer region" polyA_signal 1251..1427 /label="CaMV poly(A) signal" /note="cauliflower mosaic virus polyadenylation signal" CDS 2168..3151 /codon_start=1 /product="movement protein" /label="movement protein" /protein_id="AYC81468.1" /translation="MDLYPEENTQSEQSQNSENNMQIFKSENSDGFSSDLMISNDQLKN ISKTQLTLEKEKIFKMPNVLSQVMKKAFSRKNEIHYCVSTKELSVDIHDATGKVYLPLI TKEEINKRLSSLKPEVRKTMSMVHLGAVKILLKAQFRNGIDTPIKIALIDDRINSRKDC LLGAAKGNLAYGKFMFTVYPKFGISLNTQRLNQTLSLIHDFENKNLMNKGDKVMTITYI VGYALTNSHHSIDYQSNATIELEDVFQEIGNVQQSDFCTIQNDECNWAIDIAQNKALLG AKAKTQIGNSLQIGNGASSSNTENELARVSQNIDLLKNKLKEICGE" CDS 3154..3633 /codon_start=1 /product="aphid transmission protein" /label="aphid transmission protein" /protein_id="AYC81469.1" /translation="MSITGQPHVYKKDTIIRLKPLSLNSNNRSYVFSSSKGNIQNIINH LNNLNEIVGRSLLGIWKINSYFGLSKDPSESKSKNPSVFNTAKTIFKSGGVDYSSQLKE IKSLLESQNTRIKSLEKAIQSLDDKIEPEPLTKEEVKELKESINSIKEGLKNIIG" CDS 3635..4021 /note="Virion-associated protein from Cauliflower mosaic virus (strain Strasbourg). Accession#: P03551" /label="Virion-associated protein" CDS 4006..5469 /codon_start=1 /product="capsid protein" /label="capsid protein" /protein_id="AYC81471.1" /translation="MAESILDRTINRFWYNLGEDCLSESQFDLMIRLMEESLDGDQIID LTSLPSDNLQVEQVMTTTEDSISEESEFLLAIGETSEDESDSGEEPEFEQVRMDRTGGT EIPKEEDGEPSRYNERKRKTPEDRYFPTQPKTIPGQKQTSMGMLNIDCQTNRRTLIDDW AAEIGLIVKTNREDYLDPETILLLMEHKTSGIAKELIRNTRWNRTTGDIIEQVIDAMYT MFLGLNYSDNKVAEKIDEQEKAKIRMTKLQLCDICYLEEFTCDYEKNMYKTELADFPGY INQYLSKIPIIGEKALTRFRHEANGTSTYSLGFAAKIVKEELSKICDLSKKQKKLKKFN KKCCSIGEASVEYGCKKTSKKKYHKRYKKKYKVYKPYKKKKKFRSGKYFKPKEKKGSKQ KYCPKGKKDCRCWICNIEGHYANECPNRQSSEKAHILQQAENLGLQPIEEPYEGVQEVF ILEYKEEEEETSTEESDDGSSTSEDSDSD" CDS 5432..7468 /note="Enzymatic polyprotein from Cauliflower mosaic virus (strain Strasbourg). Accession#: P03554" /label="Enzymatic polyprotein" promoter 8891..9236 /label="CaMV 35S promoter" /note="strong constitutive promoter from cauliflower mosaic virus" polyA_signal 9281..9457 /label="CaMV poly(A) signal" /note="cauliflower mosaic virus polyadenylation signal" regulatory 9903..10158 /label="nos terminator" /note="nos terminator" /regulatory_class="terminator" terminator 9906..10158 /label="NOS terminator" /note="nopaline synthase terminator and poly(A) signal" misc_feature 10223..10246 /label="RB" /note="RB" regulatory 10311..10351 /label="bacterial terminator" /note="bacterial terminator" /regulatory_class="terminator" CDS complement(10398..11210) /label="KanR" /note="aminoglycoside phosphotransferase" CDS complement(11339..11998) /label="pBBR1 Rep" /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" rep_origin complement(11999..12770) /direction=LEFT /label="pBBR1 oriV" /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication"
This page is informational only.