pLvCmvMYOCD2aHA vector (V004903)

LOCUS       V004903                 9943 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004903
VERSION     V004903
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 9943)
  AUTHORS   van Tuyn J, Sluiter JP, Swildens J, Goumans M-J., Doevendans PA, van
            der Laarse A, Schalij MJ, Atsma DE, de Vries AA.
  TITLE     Gene expression profiling of myocardin-transduced human cardiac
            progenitor cells
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 9943)
  AUTHORS   van Tuyn J.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2007) MCB, LUMC, Einthovenweg 20, Leiden, ZH
            2333ZH, the Netherlands
REFERENCE   3  (bases 1 to 9943)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9943)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (25-JUN-2007) MCB, LUMC, Einthovenweg 20, Leiden, ZH 2333ZH, the
            Netherlands"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9943
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        3..229
                     /label="RSV promoter"
                     /note="Rous sarcoma virus enhancer/promoter"
     repeat_region   212..410
     LTR             230..410
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     misc_feature    457..582
                     /label="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus
                     type 1"
     misc_feature    1075..1308
                     /label="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for
                     Rev-dependent mRNA export from the nucleus to the
                     cytoplasm."
     CDS             1493..1537
                     /label="gp41 peptide"
                     /note="antigenic peptide corresponding to amino acids 655
                     to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
                     al., 2013)"
     CDS             1686..1727
                     /note="Protein Tat from Human immunodeficiency virus type 1
                     group M subtype B (isolate WMJ22). Accession#: P12509"
                     /label="Protein Tat"
     misc_feature    1799..1916
                     /label="cPPT/CTS"
                     /note="central polypurine tract and central termination
                     sequence of HIV-1"
     enhancer        1939..2242
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        2243..2446
                     /label="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     CDS             2650..2775
                     /codon_start=1
                     /gene="MYOCD"
                     /product="truncated cardiac myocardin"
                     /label="MYOCD"
                     /note="N-terminal region"
                     /protein_id="ABS20111.1"
                     /translation="MTLLGSEHSLLIRSKFRSVLQLRLQQRRTQEQLANQGIIPH"
     CDS             5661..5687
                     /label="HA"
                     /note="HA (human influenza hemagglutinin) epitope tag"
     misc_feature    5730..6318
                     /label="WPRE"
                     /note="woodchuck hepatitis virus posttranscriptional
                     regulatory element"
     LTR             6457..6690
                     /label="3' LTR (Delta-U3)"
                     /note="self-inactivating 3' long terminal repeat (LTR) from
                     HIV-1"
     polyA_signal    6762..6896
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     rep_origin      6923..7058
                     /label="SV40 ori"
                     /note="SV40 origin of replication"
     promoter        complement(7079..7097)
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(7107..7123)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     rep_origin      7268..7723
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        7752..7856
                     /label="AmpR promoter"
     CDS             7857..8714
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      8888..9476
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     protein_bind    9764..9785
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        9801..9831
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    9839..9855
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     9863..9879
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        9900..9918
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"