pLUMCL vector (V004918)

LOCUS       V004918                10263 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004918
VERSION     V004918
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 10263)
  AUTHORS   Shahana S, Childers DS, Ballou ER, Bohovych I, Odds FC, Gow NA,
            Brown AJ.
  TITLE     New Clox Systems for Rapid and Efficient Gene Disruption in Candida
            albicans
  JOURNAL   PLoS ONE 9 (6), E100390 (2014)
   PUBMED   24940603
REFERENCE   2  (bases 1 to 10263)
  AUTHORS   Shahana S, Childers DS, Brown AJP.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAY-2013) Microbiology, School of Medical Sciences,
            Institute of Medical Sciences - Foresterhill, Aberdeen,
            Aberdeenshire AB25 2ZD, United Kingdom
REFERENCE   3  (bases 1 to 10263)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10263)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
            date: "2014"; volume: "9"; issue: "6"; pages: "E100390"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (01-MAY-2013) Microbiology, School of Medical Sciences, Institute of
            Medical Sciences - Foresterhill, Aberdeen, Aberdeenshire AB25 2ZD,
            United Kingdom"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10263
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(666..1757)
                     /label="LEU2"
                     /note="3-isopropylmalate dehydrogenase, required for
                     leucine biosynthesis"
     promoter        complement(1770..2174)
                     /label="LEU2 promoter"
     rep_origin      complement(2474..2929)
                     /direction=LEFT
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     3074..3090
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        3097..3115
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     3148..3164
                     /label="SK primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    3178..3211
                     /label="loxP"
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core
                     sequence (GCATACAT)."
     CDS             3641..4450
                     /gene="URA3"
                     /label="Orotidine 5'-phosphate decarboxylase"
                     /note="Orotidine 5'-phosphate decarboxylase from Candida
                     albicans (strain SC5314 / ATCC MYA-2876). Accession#:
                     P13649"
     regulatory      4595..5926
                     /gene="pMET3"
                     /label="MET3 promoter"
                     /note="MET3 promoter"
                     /regulatory_class="promoter"
     gene            4595..5926
                     /gene="pMET3"
                     /label="pMET3"
     CDS             5954..6361
                     /codon_start=1
                     /product="Cre"
                     /label="Cre"
                     /note="Cre recombinase"
                     /protein_id="AGZ63437.1"
                     /translation="MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKML
                     LSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGL
                     PRPSDSNAVSLVMRRIRKENVDAGERAKQAL"
     protein_bind    complement(7365..7398)
                     /label="loxP"
                     /note="Cre-mediated recombination occurs in the 8-bp core
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     primer_bind     complement(7443..7459)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        complement(7489..7507)
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(7528..7544)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    7552..7568
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(7576..7606)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(7621..7642)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(7930..8518)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(8692..9549)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(9550..9654)
                     /label="AmpR promoter"
     misc_feature    9691..10194
                     /label="CEN/ARS"
                     /note="S. cerevisiae CEN6 centromere fused to an
                     autonomously replicating sequence"