Basic Vector Information
- Vector Name:
- pLUMCL
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10263 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Shahana S, Childers DS, Ballou ER, Bohovych I, Odds FC, Gow NA, Brown AJ.
- Promoter:
- LEU2
pLUMCL vector Vector Map
pLUMCL vector Sequence
LOCUS V004918 10263 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V004918
VERSION V004918
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 10263)
AUTHORS Shahana S, Childers DS, Ballou ER, Bohovych I, Odds FC, Gow NA,
Brown AJ.
TITLE New Clox Systems for Rapid and Efficient Gene Disruption in Candida
albicans
JOURNAL PLoS ONE 9 (6), E100390 (2014)
PUBMED 24940603
REFERENCE 2 (bases 1 to 10263)
AUTHORS Shahana S, Childers DS, Brown AJP.
TITLE Direct Submission
JOURNAL Submitted (01-MAY-2013) Microbiology, School of Medical Sciences,
Institute of Medical Sciences - Foresterhill, Aberdeen,
Aberdeenshire AB25 2ZD, United Kingdom
REFERENCE 3 (bases 1 to 10263)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 10263)
AUTHORS .
TITLE Direct Submission
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
date: "2014"; volume: "9"; issue: "6"; pages: "E100390"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(01-MAY-2013) Microbiology, School of Medical Sciences, Institute of
Medical Sciences - Foresterhill, Aberdeen, Aberdeenshire AB25 2ZD,
United Kingdom"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..10263
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(666..1757)
/label="LEU2"
/note="3-isopropylmalate dehydrogenase, required for
leucine biosynthesis"
promoter complement(1770..2174)
/label="LEU2 promoter"
rep_origin complement(2474..2929)
/direction=LEFT
/label="f1 ori"
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 3074..3090
/label="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
promoter 3097..3115
/label="T7 promoter"
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind 3148..3164
/label="SK primer"
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 3178..3211
/label="loxP"
/bound_moiety="Cre recombinase"
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (GCATACAT)."
CDS 3641..4450
/gene="URA3"
/label="Orotidine 5'-phosphate decarboxylase"
/note="Orotidine 5'-phosphate decarboxylase from Candida
albicans (strain SC5314 / ATCC MYA-2876). Accession#:
P13649"
regulatory 4595..5926
/gene="pMET3"
/label="MET3 promoter"
/note="MET3 promoter"
/regulatory_class="promoter"
gene 4595..5926
/gene="pMET3"
/label="pMET3"
CDS 5954..6361
/codon_start=1
/product="Cre"
/label="Cre"
/note="Cre recombinase"
/protein_id="AGZ63437.1"
/translation="MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKML
LSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGL
PRPSDSNAVSLVMRRIRKENVDAGERAKQAL"
protein_bind complement(7365..7398)
/label="loxP"
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
primer_bind complement(7443..7459)
/label="KS primer"
/note="common sequencing primer, one of multiple similar
variants"
promoter complement(7489..7507)
/label="T3 promoter"
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(7528..7544)
/label="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 7552..7568
/label="lac operator"
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(7576..7606)
/label="lac promoter"
/note="promoter for the E. coli lac operon"
protein_bind complement(7621..7642)
/label="CAP binding site"
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(7930..8518)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(8692..9549)
/label="AmpR"
/note="beta-lactamase"
promoter complement(9550..9654)
/label="AmpR promoter"
misc_feature 9691..10194
/label="CEN/ARS"
/note="S. cerevisiae CEN6 centromere fused to an
autonomously replicating sequence"
This page is informational only.