Basic Vector Information
- Vector Name:
- pLT_88
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6400 bp
- Type:
- Cloning vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Tian L.
pLT_88 vector Vector Map
pLT_88 vector Sequence
LOCUS V004923 6400 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004923 VERSION V004923 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6400) AUTHORS Tian L. TITLE Elucidation of the ethanol tolerance mechanism of Clostridium thermocellum by metabolome analysis JOURNAL Unpublished REFERENCE 2 (bases 1 to 6400) AUTHORS Tian L. TITLE Direct Submission JOURNAL Submitted (18-JUL-2017) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 6400) TITLE Direct Submission REFERENCE 4 (bases 1 to 6400) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-JUL-2017) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6400 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1..1002 /label="repB" /note="RepB replication protein" CDS 1281..2288 /codon_start=1 /gene="Gapdh" /product="Gapdh" /label="Gapdh" /note="derived from Thermoanaerobacterium saccharolyticum" /protein_id="AWT04834.1" /translation="MAVKVGINGFGRIGRNFFRAALKKNVDLDIVAFNDLTDAKTLAHL LKYDSTFGQFEGEVIAKEDSLVVNGKEIKILKETDPAKLPWKELGVDIVIESTGRFTNK EDAVKHIEAGAKKVIISAPAKNEDITIVMGVNEDKYDPNAHHVISNASCTTNCLAPFAK VLHNKFGIKRGLMTTVHSYTNDQRILDLPHKDLRRARSAAMSIIPTTTGAAKAVALVLP ELKGKLNGFAMRVPTPDVSVVDLVAELEKSVTVEEVNAALKEAAENELKGILGYTDEPL VSMDFKGDSRSSIVDGLSTMVMEGNMVKVVSWYDNEWGYSNRVVDLAKYVADRL" gene 1281..2288 /gene="Gapdh" /label="Gapdh" CDS 2430..3077 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS complement(3161..4018) /label="AmpR" /note="beta-lactamase" promoter complement(4019..4110) /label="AmpR promoter" rep_origin 4869..5091 /label="pSC101 ori" /note="low-copy replication origin that requires the Rep101 protein" CDS 5139..6086 /label="Rep101" /note="RepA protein needed for replication with the pSC101 origin"
This page is informational only.