Basic Vector Information
- Vector Name:
- pLT_78
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3268 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Tian L.
- Promoter:
- rhaB
pLT_78 vector Vector Map
pLT_78 vector Sequence
LOCUS 40924_28811 3268 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLT_78, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3268) AUTHORS Tian L. TITLE Elucidation of the ethanol tolerance mechanism of Clostridium thermocellum by metabolome analysis JOURNAL Unpublished REFERENCE 2 (bases 1 to 3268) AUTHORS Tian L. TITLE Direct Submission JOURNAL Submitted (18-JUL-2017) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 3268) TITLE Direct Submission REFERENCE 4 (bases 1 to 3268) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-JUL-2017) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3268 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 37..84 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" terminator 182..211 /label=T3Te terminator /note="phage T3 early transcription terminator" rep_origin 308..896 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(1028..1055) /label=T7Te terminator /note="phage T7 early transcription terminator" CDS complement(1082..1888) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" promoter complement(1889..1979) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" terminator 1988..2018 /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" promoter 2083..2201 /label=rhaB promoter /note="promoter of the E. coli rhaBAD operon, conferring tight induction with L-rhamnose and repression with D-glucose in the presence of RhaR and RhaS (Giacalone et al., 2006)" RBS 2220..2228 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" CDS 2240..2257 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 2258..3268 /codon_start=1 /gene="Gapdh" /product="Gapdh" /label=Gapdh /note="derived from Clostridium thermocellum" /protein_id="AWT04838.1" /translation="MAVKIGINGFGRIGRLVFRASLNNPNVEVVGINDPFIDLEYMQYM LKYDTVHGQFKGEISQDNGKLVVNGRKISVYGFTDPAEIPWSECGAEYIVESTGVFTTT EKASAHFKGGAKKVVISAPSADAPMFVMGVNHDKYTKDMNVVSNASCTTNCLAPLAKVI HENFGIVEGLMTTVHATTATQKTVDGPSKKDWRGGRAAAGNIIPSSTGAAKAVGKVIPE LNGKLTGMAFRVPTLDVSVVDLTCRLEKPATYDEIKAAVKKASENELKGILGYTEDAVV SSDFIGDPRTSIFDAEAGISLNSNFVKLVAWYDNEWGYSNKVVDLIVHMASVDAK" gene 2258..3268 /gene="Gapdh" /label=Gapdh
This page is informational only.