Basic Vector Information
- Vector Name:
- pLT-26
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5393 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Tian L, Lo J, Shao X, Zheng T, Olson DG, Lynd LR.
pLT-26 vector Map
pLT-26 vector Sequence
LOCUS V004929 5393 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004929 VERSION V004929 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5393) AUTHORS Tian L, Lo J, Shao X, Zheng T, Olson DG, Lynd LR. TITLE Identification of a ferredoxin:NAD+ oxidoreductase enzyme in Thermoanaerobacterium saccharolyticum and its role in ethanol formation JOURNAL Appl. Environ. Microbiol. (2016) In press PUBMED 27694237 REFERENCE 2 (bases 1 to 5393) AUTHORS Tian L. TITLE Direct Submission JOURNAL Submitted (22-MAY-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 5393) TITLE Direct Submission REFERENCE 4 (bases 1 to 5393) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol. (2016) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-MAY-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5393 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(66..654) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(828..1685) /label="AmpR" /note="beta-lactamase" promoter complement(1686..1790) /label="AmpR promoter" misc_recomb 1902..2371 misc_recomb 2371..2372 CDS 3377..4138 /codon_start=1 /product="HTK" /label="HTK" /note="KanR" /protein_id="AOU74533.1" /translation="MKGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTD GPYSDIEMMCVLSTEGVEFSYEWTTGEWKAEVNFYSEEILLDYASRVEPDWPLTHGRFF SILPIYDPGGYFEKVYQTAKSVEAQKFHDAICALIVEELFEYAGKWRNIRVQGPTTFLP SLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQPDLPPGYVQLCQLVMSGQLSDPEK LLESLENFWNGVQEWAERHGYIVDVSKRIPF" CDS 4162..4740 /gene="tdk" /label="Thymidine kinase" /note="Thymidine kinase from Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E). Accession#: B0K7G9" misc_recomb 4822..5283
This page is informational only.