Basic Vector Information
- Vector Name:
- pLSU-1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4566 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Source/Author:
- Lee S, Su G, Lasserre E, Aghazadeh MA, Murai N.
pLSU-1 vector Vector Map
pLSU-1 vector Sequence
LOCUS 40924_28776 4566 bp DNA circular SYN 18-DEC-2018 DEFINITION Binary vector pLSU-1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4566) AUTHORS Lee S, Su G, Lasserre E, Aghazadeh MA, Murai N. TITLE Small high-yielding binary Ti vectors pLSU with co-directional replicons for Agrobacterium tumefaciens-mediated transformation of higher plants JOURNAL Plant Sci. 187, 49-58 (2012) PUBMED 22404832 REFERENCE 2 (bases 1 to 4566) AUTHORS Lee S. TITLE Direct Submission JOURNAL Submitted (11-OCT-2010) Plant Pathology and Crop Physiology, Louisiana State University, 302 Life Science Bldg, Baton Rouge, LA 70820, USA REFERENCE 3 (bases 1 to 4566) TITLE Direct Submission REFERENCE 4 (bases 1 to 4566) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Sci. 187, 49-58 (2012)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-OCT-2010) Plant Pathology and Crop Physiology, Louisiana State University, 302 Life Science Bldg, Baton Rouge, LA 70820, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4566 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 111..923 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1012..1600 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_binding 1673..1695 /label=dnaA binding site /bound_moiety="dnaA" CDS 1846..2472 /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI" CDS 2904..3974 /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="VSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE ALISRYKIVKSETGRPEYIEIELVDWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI LVMRYRNLIEGEASAGS" rep_origin 4043..4237 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 4404..4427 /label=T-DNA left border repeat /note="T-DNA left border repeat" misc_feature 4500..4561 /label=T-DNA right border repeat /note="T-DNA right border repeat"
This page is informational only.