Basic Vector Information
- Vector Name:
- pLSP2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3792 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Lehman SS, Mladinich KM, Boonyakanog A, Mima T, Karkhoff-Schweizer RR, Schweizer HP.
pLSP2 vector Vector Map
pLSP2 vector Sequence
LOCUS 40924_28761 3792 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLSP2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3792) AUTHORS Lehman SS, Mladinich KM, Boonyakanog A, Mima T, Karkhoff-Schweizer RR, Schweizer HP. TITLE Versatile nourseothricin and streptomycin/spectinomycin resistance gene cassettes and their use in chromosome integration vectors JOURNAL J. Microbiol. Methods 129, 8-13 (2016) PUBMED 27457407 REFERENCE 2 (bases 1 to 3792) AUTHORS Lehman SS, Mladinich K, Boonyakanog A, Mima T, Karkhoff-Schweizer RR, Schweizer HP. TITLE Direct Submission JOURNAL Submitted (17-MAR-2016) Molecular Genetics and Microbiology, University of Florida, 2055 Mowry Road, Gainesville, FL 32610, USA REFERENCE 3 (bases 1 to 3792) TITLE Direct Submission REFERENCE 4 (bases 1 to 3792) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Microbiol. Methods 129, 8-13 (2016)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-MAR-2016) Molecular Genetics and Microbiology, University of Florida, 2055 Mowry Road, Gainesville, FL 32610, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3792 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(184..772) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(946..1803) /label=AmpR /note="beta-lactamase" promoter complement(1804..1908) /label=AmpR promoter primer_bind 2380..2396 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 2400..2444 /note="MCS; multiple cloning site" misc_feature 2450..2482 /note="loxP; Cre recombinase site" regulatory 2550..2603 /label=chloramphenicol transacetylase gene promoter /note="chloramphenicol transacetylase gene promoter" /regulatory_class="promoter" regulatory 2567..2572 /regulatory_class="minus_35_signal" regulatory 2590..2595 /regulatory_class="minus_10_signal" regulatory 2637..2641 /regulatory_class="ribosome_binding_site" CDS 2649..3401 /codon_start=1 /gene="aad9" /product="spectinomycin adenyltransferase" /label=aad9 /protein_id="ANY60775.1" /translation="MNTYEQINKVKKILRKHLKNNLIGTYMFGSGVESGLKPNSDLDFL VVVSEPLTDQSKEILIQKIRPISKKIGDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYG EWLQELYEQGYIPQKELNSDLTIMLYQAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMD SSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERILLAVR SYLGENIEWTNENVNLTINYLNNRLKKL" gene 2649..3401 /gene="aad9" /label=aad9 /note="codon optimized; derived from Enterococcus faecalis" regulatory 3402..3443 /regulatory_class="terminator" protein_bind complement(3479..3512) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." misc_feature 3517..3561 /note="MCS; multiple cloning site" primer_bind complement(3574..3590) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3598..3614) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3622..3652) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3667..3688) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP."
This page is informational only.