Basic Vector Information
- Vector Name:
- pLS3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5070 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hays LB, Chen Y-S.A., Hu JC.
pLS3 vector Map
pLS3 vector Sequence
LOCUS 40924_28726 5070 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLS3, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5070) AUTHORS Hays LB, Chen Y-S.A., Hu JC. TITLE A two-hybrid system for characterization of protein-protein interactions in E. coli JOURNAL Unpublished REFERENCE 2 (bases 1 to 5070) AUTHORS Hays LB, Chen Y-S.A., Hu JC. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 5070) TITLE Direct Submission REFERENCE 4 (bases 1 to 5070) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-JUL-1999) Biochemistry " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5070 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 28..58 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" protein_bind 66..82 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 109..525 /codon_start=1 /product="434-GCN4-linker" /label=434-GCN4-linker /note="fusion protein; contains N-terminal DNA binding domain from bacteriophage 434 repressor, a modified leucine zipper from GCN4 and a linker for fusion to additional protein domains" /protein_id="AAD50896.1" /translation="MSISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRF LPELASALGVSVDWLLNGTSDSNVRFVGHVEPKGKKLRTFTKGDAERWVSTHMKQLEDK IEELLSKNYHLENEIARLKKLIGERGGQLNASGS" terminator 599..646 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS 2131..2319 /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" misc_feature 2424..2564 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(2750..3338) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" rep_origin 3449..3962 /label=M13 ori /note="M13 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(4007..4864) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(4865..4969) /label=AmpR promoter
This page is informational only.