Basic Vector Information
- Vector Name:
- pLNMCL
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10495 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Shahana S, Childers DS, Ballou ER, Bohovych I, Odds FC, Gow NA, Brown AJ.
- Promoter:
- LEU2
pLNMCL vector Vector Map
pLNMCL vector Sequence
LOCUS 40924_28556 10495 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLNMCL, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10495) AUTHORS Shahana S, Childers DS, Ballou ER, Bohovych I, Odds FC, Gow NA, Brown AJ. TITLE New Clox Systems for Rapid and Efficient Gene Disruption in Candida albicans JOURNAL PLoS ONE 9 (6), E100390 (2014) PUBMED 24940603 REFERENCE 2 (bases 1 to 10495) AUTHORS Shahana S, Childers DS, Brown AJP. TITLE Direct Submission JOURNAL Submitted (01-MAY-2013) Microbiology, School of Medical Sciences, Institute of Medical Sciences - Foresterhill, Aberdeen, Aberdeenshire AB25 2ZD, United Kingdom REFERENCE 3 (bases 1 to 10495) TITLE Direct Submission REFERENCE 4 (bases 1 to 10495) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2014"; volume: "9"; issue: "6"; pages: "E100390" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-MAY-2013) Microbiology, School of Medical Sciences, Institute of Medical Sciences - Foresterhill, Aberdeen, Aberdeenshire AB25 2ZD, United Kingdom" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10495 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(666..1757) /label=LEU2 /note="3-isopropylmalate dehydrogenase, required for leucine biosynthesis" promoter complement(1770..2174) /label=LEU2 promoter rep_origin complement(2474..2929) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 3074..3090 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3097..3115 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 3148..3164 /label=SK primer /note="common sequencing primer, one of multiple similar variants" protein_bind 3178..3211 /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." terminator complement(3622..3819) /label=TEF terminator /note="Ashbya gossypii TEF terminator" CDS complement(3837..4400) /label=NrsR /note="nourseothricin acetyltransferase" promoter complement(4420..4763) /label=TEF promoter /note="Ashbya gossypii TEF promoter" regulatory 4827..6158 /gene="pMET3" /label=MET3 promoter /note="MET3 promoter" /regulatory_class="promoter" gene 4827..6158 /gene="pMET3" /label=pMET3 CDS 6186..6593 /codon_start=1 /product="Cre" /label=Cre /note="Cre recombinase" /protein_id="AGZ63435.1" /translation="MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKML LSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGL PRPSDSNAVSLVMRRIRKENVDAGERAKQAL" protein_bind complement(7597..7630) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." primer_bind complement(7675..7691) /label=KS primer /note="common sequencing primer, one of multiple similar variants" promoter complement(7721..7739) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(7760..7776) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 7784..7800 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(7808..7838) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(7853..7874) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(8162..8750) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8924..9781) /label=AmpR /note="beta-lactamase" promoter complement(9782..9886) /label=AmpR promoter misc_feature 9923..10426 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence"
This page is informational only.