Basic Vector Information
- Vector Name:
- pLN-YC-Nano50
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8396 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Pandey K, Ferreira PE, Ishikawa T, Nagai T, Kaneko O, Yahata K.
pLN-YC-Nano50 vector Map
pLN-YC-Nano50 vector Sequence
LOCUS 40924_28531 8396 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pLN-YC-Nano50 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8396) AUTHORS Pandey K, Ferreira PE, Ishikawa T, Nagai T, Kaneko O, Yahata K. TITLE Ca2+ monitoring in Plasmodium falciparum through yellow cameleon-Nano biosensor JOURNAL Unpublished REFERENCE 2 (bases 1 to 8396) AUTHORS Yahata K, Kaneko O. TITLE Direct Submission JOURNAL Submitted (19-AUG-2015) Contact:Kazuhide Yahata Institute of Tropical Medicine, Nagasaki University, Department of Parasitology; 1-12-4 Sakamoto, Nagasaki, Nagasaki 852-8042, Japan REFERENCE 3 (bases 1 to 8396) TITLE Direct Submission REFERENCE 4 (bases 1 to 8396) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-AUG-2015) Contact:Kazuhide Yahata Institute of Tropical Medicine, Nagasaki University, Department of Parasitology; 1-12-4 Sakamoto, Nagasaki, Nagasaki 852-8042, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8396 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 152..172 /label=attB4 /note="core recombination site for the Gateway(R) BP reaction" protein_bind 1029..1053 /label=attB1 /note="recombination site for the Gateway(R) BP reaction" protein_bind complement(1066..1090) /label=attB2 /note="recombination site for the Gateway(R) BP reaction" CDS 1092..1772 /codon_start=1 /label=GFP /note="green fluorescent protein" /translation="VSKGEELFTGVVPILVELDGDVNGHRFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKA HFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAA" CDS 2232..2309 /codon_start=1 /product="calmodulin-binding peptide" /label=CBP /note="derived from skeletal muscle myosin light chain kinase; binds calmodulin with nanomolar affinity in the presence of calcium" /translation="KRRWKKNFIAVSAANRFKKISSSGAL" CDS 2532..3050 /codon_start=1 /product="N-terminal fragment of mVenus for use in bimolecular fluorescence complementation (BiFC) (Kodama and Hu, 2010)" /label=VN173 /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK ANFKIRHNIE" protein_bind complement(3066..3086) /label=attB3 /note="core recombination site for the Gateway(R) BP reaction" primer_bind complement(3094..3110) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 4333..4437 /label=AmpR promoter CDS 4438..5295 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 5469..6057 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 6345..6366 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 6381..6411 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 6419..6435 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 6443..6459 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 6477..6495 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" CDS 7180..7572 /codon_start=1 /label=BSD /note="blasticidin S deaminase" /translation="AKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFTGV NVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPGIK AIVKDSDGQPTAVGIRELLPSGYVWEG" promoter complement(8303..8320) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(8327..8343) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.