Basic Vector Information
- Vector Name:
- pLN-YC Nano15
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8402 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Yahata K.
- Promoter:
- SP6
pLN-YC Nano15 vector Map
pLN-YC Nano15 vector Sequence
LOCUS 40924_28526 8402 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLN-YC Nano15 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8402) AUTHORS Yahata K. TITLE Yellow Cameleon-Nano biosensors for calcium monitoring against inhibitors for sarco/endoplasmic reticulum Ca2+-ATPase in Plasmodium falciparum JOURNAL Unpublished REFERENCE 2 (bases 1 to 8402) AUTHORS Yahata K. TITLE Direct Submission JOURNAL Submitted (18-FEB-2015) Contact:Kazuhide Yahata Institute of Tropical Medicine, Protozoology; 1-12-4 Sakamoto, Nagasaki, Nagasaki 852-8523, Japan URL :http://www.tm.nagasaki-u.ac.jp/protozoology/index.html REFERENCE 3 (bases 1 to 8402) TITLE Direct Submission REFERENCE 4 (bases 1 to 8402) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-FEB-2015) Contact:Kazuhide Yahata Institute of Tropical Medicine, Protozoology"; volume: " 1-12-4 Sakamoto, Nagasaki, Nagasaki 852-8523, Japan URL :http"; pages: "//www.tm.nagasaki-u.ac.jp/protozoology/index.htm" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8402 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 152..172 /label=attB4 /note="core recombination site for the Gateway(R) BP reaction" protein_bind 1029..1053 /label=attB1 /note="recombination site for the Gateway(R) BP reaction" protein_bind complement(1066..1090) /label=attB2 /note="recombination site for the Gateway(R) BP reaction" CDS 1092..1772 /codon_start=1 /label=GFP /note="green fluorescent protein" /translation="VSKGEELFTGVVPILVELDGDVNGHRFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKA HFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAA" CDS 2238..2315 /codon_start=1 /product="calmodulin-binding peptide" /label=CBP /note="derived from skeletal muscle myosin light chain kinase; binds calmodulin with nanomolar affinity in the presence of calcium" /translation="KRRWKKNFIAVSAANRFKKISSSGAL" CDS 2538..3056 /codon_start=1 /product="N-terminal fragment of mVenus for use in bimolecular fluorescence complementation (BiFC) (Kodama and Hu, 2010)" /label=VN173 /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK ANFKIRHNIE" protein_bind complement(3072..3092) /label=attB3 /note="core recombination site for the Gateway(R) BP reaction" primer_bind complement(3100..3116) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 4339..4443 /label=AmpR promoter CDS 4444..5301 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 5475..6063 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 6351..6372 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 6387..6417 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 6425..6441 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 6449..6465 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 6483..6501 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" CDS 7186..7578 /codon_start=1 /label=BSD /note="blasticidin S deaminase" /translation="AKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFTGV NVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPGIK AIVKDSDGQPTAVGIRELLPSGYVWEG" promoter complement(8309..8326) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(8333..8349) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.