Basic Vector Information
- Vector Name:
- pLMB51
- Antibiotic Resistance:
- Ampicillin
- Length:
- 13893 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Tett AJ, Rudder SJ, Bourdes A, Karunakaran R, Poole PS.
pLMB51 vector Map
pLMB51 vector Sequence
LOCUS V004973 13893 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004973 VERSION V004973 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 13893) AUTHORS Tett AJ, Rudder SJ, Bourdes A, Karunakaran R, Poole PS. TITLE Regulatable vectors for environmental gene expression in alphaproteobacteria JOURNAL Appl. Environ. Microbiol. 78 (19), 7137-7140 (2012) PUBMED 22820336 REFERENCE 2 (bases 1 to 13893) AUTHORS Poole PS. TITLE Direct Submission JOURNAL Submitted (03-APR-2012) Molecular Microbiology, John Innes Centre, Colney Lane, Norwich NR47UH, UK REFERENCE 3 (bases 1 to 13893) TITLE Direct Submission REFERENCE 4 (bases 1 to 13893) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2012"; volume: "78"; issue: "19"; pages: "7137-7140" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (03-APR-2012) Molecular Microbiology, John Innes Centre, Colney Lane, Norwich NR47UH, UK" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..13893 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(733..1392) /codon_start=1 /gene="parA" /product="ParA" /label="parA" /protein_id="AFR24674.1" /translation="MATREQQPEGRRLKVARIYLRASTDEQNLERQESLVAATRAAGYY VAGIYREKASGARADRPELLRMIADLQPGEVVVAEKIDRISRLPLAEAERLVASIRAKG AKLAVPGVVDLSELAAEANGVAKIVLESVQDMLLKLALQMARDDYEDRRERQRQGVQLA KAAGRYTGRKRDAGMHDRIITLRSGGSSIAKTAKLVGCSPSQVKRVWAAWNAQQQK" gene complement(733..1392) /gene="parA" /label="parA" CDS complement(1356..1886) /gene="parB" /label="Protein ParB" /note="Protein ParB from Escherichia coli. Accession#: P22997" CDS complement(1883..2176) /codon_start=1 /gene="parC" /product="ParC" /label="parC" /note="partition protein" /protein_id="AFR24675.1" /translation="MGIPNLTKGDAMRAAKHYRQLLSIDFNIEALAFVPGPDGTRGRRI HVLGREVRDRPGLVEYLSPAFGSRVALDGYCKANFDAVLHLAYPDHQQWGHA" gene complement(1883..2176) /gene="parC" /label="parC" CDS 2327..2575 /gene="parD" /label="Antitoxin ParD" /note="Antitoxin ParD from Escherichia coli. Accession#: P22995" CDS 2575..2883 /gene="parE" /label="Toxin ParE" /note="Toxin ParE from Escherichia coli. Accession#: Q79EC5" primer_bind complement(3289..3305) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3313..3329) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3337..3367) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(3382..3403) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." oriT complement(3594..3702) /direction=LEFT /label="oriT" /note="incP origin of transfer" promoter 3885..3989 /label="AmpR promoter" CDS 3990..4847 /label="AmpR" /note="beta-lactamase" CDS complement(5373..6569) /label="TcR" /note="tetracycline efflux protein" CDS 6675..7322 /label="TetR" /note="tetracycline resistance regulatory protein" rep_origin 7814..8517 /label="oriV" /note="incP origin of replication" CDS 9184..10329 /label="trfA" /note="trans-acting replication protein that binds to and activates oriV" CDS complement(10383..12191) /label="GUS" /note="beta-glucuronidase" regulatory 12241..12397 /gene="tauAp_tauR" /regulatory_class="promoter" gene 12241..12397 /gene="tauAp_tauR" /label="tauAp_tauR"
This page is informational only.