Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V004974 | pLMB509 | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pLMB509
- Antibiotic Resistance:
- Gentamycin
- Length:
- 6879 bp
- Type:
- Cloning vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Tett AJ, Rudder SJ, Bourdes A, Karunakaran R, Poole PS.
- Promoter:
- Pc
pLMB509 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pLMB509 vector Sequence
LOCUS 40924_28481 6879 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLMB509, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6879) AUTHORS Tett AJ, Rudder SJ, Bourdes A, Karunakaran R, Poole PS. TITLE Regulatable vectors for environmental gene expression in alphaproteobacteria JOURNAL Appl. Environ. Microbiol. 78 (19), 7137-7140 (2012) PUBMED 22820336 REFERENCE 2 (bases 1 to 6879) AUTHORS Tett A, Rudder S, Bourdes A, Poole P. TITLE Direct Submission JOURNAL Submitted (03-APR-2012) Molecular Microbiology, John Innes Centre, Colney Lane, Norwich NR47UH, UK REFERENCE 3 (bases 1 to 6879) TITLE Direct Submission REFERENCE 4 (bases 1 to 6879) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2012"; volume: "78"; issue: "19"; pages: "7137-7140" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (03-APR-2012) Molecular Microbiology, John Innes Centre, Colney Lane, Norwich NR47UH, UK" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6879 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 171..884 /label=yeGFP /note="yeast-enhanced green fluorescent protein" CDS 891..908 /label=6xHis /note="6xHis affinity tag" terminator 942..1028 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" CDS complement(1720..2379) /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" rep_origin complement(2380..3149) /direction=LEFT /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS 3373..4377 /codon_start=1 /gene="mob" /product="Mob" /label=mob /note="mobilisation protein" /protein_id="AFR24685.1" /translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLAAL" gene 3373..4377 /gene="mob" /label=mob CDS complement(4435..4965) /label=GmR /note="gentamycin acetyltransferase" promoter complement(5154..5182) /label=Pc promoter /note="class 1 integron promoter" regulatory complement(5395..6879) /gene="tauA_tauR" /regulatory_class="promoter" gene complement(5395..6879) /gene="tauA_tauR" /label=tauA_tauR