Basic Vector Information
- Vector Name:
- pLM3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5042 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Marino-Ramirez L, Hu JC.
pLM3 vector Map
pLM3 vector Sequence
LOCUS 40924_28471 5042 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLM3, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5042) AUTHORS Marino-Ramirez L, Hu JC. TITLE Lambda repressor fusion vectors to map protein-protein interactions JOURNAL Unpublished REFERENCE 2 (bases 1 to 5042) AUTHORS Marino-Ramirez L, Hu JC. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 5042) TITLE Direct Submission REFERENCE 4 (bases 1 to 5042) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (23-AUG-1999) Biochemistry and Biophysics, Texas A " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5042 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 6..47 /regulatory_class="promoter" CDS 73..462 /codon_start=1 /product="lambda repressor protein" /label=lambda repressor protein /note="DNA binding domain" /experiment="experimental evidence, no additional details recorded" /protein_id="AAF01197.1" /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY PVFSHVQAGMFSPKLRTFTKGDAER" terminator 571..618 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS 2103..2291 /label=rop /note="Rop protein, which maintains plasmids at low copy number" misc_feature 2396..2536 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(2722..3310) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" rep_origin 3421..3934 /label=M13 ori /note="M13 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(3979..4836) /label=AmpR /note="beta-lactamase" promoter complement(4837..4941) /label=AmpR promoter
This page is informational only.