Basic Vector Information
- Vector Name:
- pLL1179
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6917 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Lo J, Olson DG, Murphy SJ, Tian L, Hon S, Lanahan A, Guss AM, Lynd LR.
pLL1179 vector Map
pLL1179 vector Sequence
LOCUS V004991 6917 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004991 VERSION V004991 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6917) AUTHORS Lo J, Olson DG, Murphy SJ, Tian L, Hon S, Lanahan A, Guss AM, Lynd LR. TITLE Engineering electron metabolism to increase ethanol production in Clostridium thermocellum JOURNAL Metab. Eng. (2016) In press PUBMED 27989806 REFERENCE 2 (bases 1 to 6917) AUTHORS Lo J, Olson DG, Murphy SJL., Tian L, Hon S, Lanahan AA, Guss AM, Lynd LR. TITLE Direct Submission JOURNAL Submitted (29-NOV-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 6917) TITLE Direct Submission REFERENCE 4 (bases 1 to 6917) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Metab. Eng. (2016) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-NOV-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6917 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 1..209 /regulatory_class="promoter" CDS 210..1055 /codon_start=1 /gene="nfnA" /product="NfnA" /label="nfnA" /protein_id="APQ46211.1" /translation="MFKIVKKKILNPQVKLMEISAPHVAKKAEPGQFIILRVNENGERI PLTIADFDREKGTVTIIFQEVGKTTKLLGTLEEGDELLDFVGPLGKASHFENVKKAAVI GGGLGTAIAYPQAKKLHSMGVEVHTIAGFRNKDLIILEDEMRAVSSKLFITTDDGSNGN KGFVSDVLKKLIEEGNKYDLVVAIGPLIMMKVISELTRPYGIKTIVSMNPVMIDGTGMC GGCRVTVGGEIKFACVDGPDFDGHLVDFDEAMRRQAMYKKEESLALEKHNCKLGVEKNA " gene 210..1055 /gene="nfnA" /label="nfnA" CDS 1048..2442 /codon_start=1 /gene="nfnB" /product="NfnB" /label="nfnB" /protein_id="APQ46210.1" /translation="MPNMSPKKVPMPEQDPNVRIKNFLEVALGYTEQMAMEEAQRCLNC KHKPCVSGCPVNVKIPEFVQLIAQGKFEKAYNKIRETNNLPAICGRVCPQENQCEKFCV RGIKGEPVAIGRLERFAADWHMKNGTTSYEKPEKNGKRVAVIGSGPASLTCASDLAKLG YEVTIFEAFHVPGGVLMYGIPEFRLPKKLVQEEIETIKQLGVEIKTNMVIGKVYSIDEL KAEGYDAIFIGSGAGLPSFMKIPGENLNGVYSANEFLTRINLMKAYEFPNCDTPVKVGK NVAVVGGGNVAMDAARSAKRLGAENVYIVYRRSEAEMPARLEEIHHAKEEGILFKFLTN PTRILGTDDGWVKGMECIEMELGEPDESGRRRPVPKPGSEHVIDVETVIIAIGQTPNPL IASTTPGLATQKWGGIIVDENTGATNIEGVYAGGDAVTGAATVILAMGAGKKAAKAIDE YLKNKK" gene 1048..2442 /gene="nfnB" /label="nfnB" CDS 2572..3219 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS complement(3303..4160) /label="AmpR" /note="beta-lactamase" promoter complement(4161..4252) /label="AmpR promoter" rep_origin 4852..5397 /direction=RIGHT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." rep_origin 5687..5867 CDS 5868..6869 /label="repB" /note="RepB replication protein"
This page is informational only.