Basic Vector Information
- Vector Name:
- pLHBA
- Antibiotic Resistance:
- Streptomycin
- Length:
- 7674 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Source/Author:
- Hausmann L, Toepfer R.
pLHBA vector Map
pLHBA vector Sequence
LOCUS 40924_28277 7674 bp DNA circular SYN 18-DEC-2018
DEFINITION Binary vector pLHBA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7674)
AUTHORS Hausmann L, Toepfer R.
TITLE Development of Plasmid Vectors
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 7674)
AUTHORS Hausmann L, Toepfer R.
TITLE Direct Submission
JOURNAL Submitted (12-FEB-2003) Institute for Grapevine Breeding
Geilweilerhof, Siebeldingen 76833, Germany
REFERENCE 3 (bases 1 to 7674)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7674)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(12-FEB-2003) Institute for Grapevine Breeding Geilweilerhof,
Siebeldingen 76833, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7674
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 2..103
/note="multiple cloning site from vector pBlueSfi BA in
GenBank Accession Number AF327875"
regulatory 9..18
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
misc_difference 129
/replace="a"
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
misc_feature 148..172
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
repeat_region 196..208
/label=repeat C'
/note="repeat C'"
misc_difference 202
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
repeat_region 231..242
/label=repeat C
/note="repeat C"
repeat_region 256..266
/label=repeat B
/note="repeat B"
repeat_region 283..293
/label=repeat B
/note="repeat B"
misc_difference 288
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
misc_difference 299
/replace="a"
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
misc_feature complement(316..706)
/note="3' sequence of the ornithine cyclodeaminase gene
ocd; non-functional"
misc_difference 492
/replace="t"
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
rep_origin 817..1405
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_difference 1503..1504
/replace="gta"
/label=compared to GenBank Accession Number J01749
/note="compared to GenBank Accession Number J01749"
/experiment="experimental evidence, no additional details
recorded"
misc_feature complement(1590..1730)
/label=bom
/note="basis of mobility region from pBR322"
regulatory 2018..2023
/regulatory_class="minus_35_signal"
regulatory 2044..2049
/regulatory_class="minus_10_signal"
regulatory 2066..2070
/regulatory_class="ribosome_binding_site"
CDS 2080..2766
/codon_start=1
/product="resolvase"
/label=resolvase
/note="resolvase-like protein encoded by parR of plasmid
pVS1; similar to Tn3 resolvase in GenBank Accession Number
V00613, Tn917 resolvase in GenBank Accession Number M11180,
and RK2 ParA in GenBank Accession Number L27758"
/protein_id="AAO85341.1"
/translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT
RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT
TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI
DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE
RQEEQA"
misc_difference 2499
/replace="c"
/note="original nucleotide changed to destroy a SfiI
restriction site"
/experiment="experimental evidence, no additional details
recorded"
stem_loop 2910..2942
/label=palindromic sequence
/note="palindromic sequence"
misc_difference 2918
/replace="g"
/note="nucleotide changed to conserve palindromic sequence
following SfiI restriction site-destruction"
/experiment="experimental evidence, no additional details
recorded"
misc_difference 2933
/replace="c"
/note="original nucleotide changed to destroy two SfiI
restriction sites"
/experiment="experimental evidence, no additional details
recorded"
regulatory 3000..3005
/regulatory_class="minus_35_signal"
regulatory 3021..3026
/regulatory_class="minus_10_signal"
regulatory 3054..3061
/regulatory_class="ribosome_binding_site"
CDS 3065..3691
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
misc_feature 3961..3973
/note="identical to the korB operator binding site of
plasmid RK2 in GenBank Accession Number L27758.1"
CDS 4123..5193
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
stem_loop 5210..5232
/label=palindromic sequence
/note="palindromic sequence"
rep_origin 5262..5456
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
repeat_region 5553..5566
/label=repeat E
/rpt_unit_range=5553 .. 5559
/note="repeat E"
regulatory 5797..5802
/regulatory_class="minus_35_signal"
regulatory 5820..5825
/regulatory_class="minus_10_signal"
CDS 6061..6849
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
stem_loop 6855..6912
/note="palindromic sequence; putative termination signal"
misc_difference 7089..7090
/replace="ggtacc"
/note="compared to GenBank Accession Number X00493; removed
to destroy a KpnI restriction site"
misc_feature 7372..7396
/label=LB T-DNA repeat
/note="left border repeat from octopine Ach5 T-DNA"
This page is informational only.