pLH9000 vector (V005000)

Basic Vector Information

Vector Name:
pLH9000
Antibiotic Resistance:
Kanamycin
Length:
9154 bp
Type:
Binary vector
Replication origin:
ori
Host:
Plants
Source/Author:
Hausmann L, Toepfer R.
Promoter:
CaMV 35S

pLH9000 vector Vector Map

pLH90009154 bp40080012001600200024002800320036004000440048005200560060006400680072007600800084008800CaMV 35S promoterNeoR/KanRterminator sequence from the 35S gene of Cauliflower mosaic virus; GenBank Accession Number: X05868, M31331multiple cloning site from vector pBlueSfi BA; GenBank Accession Number: AF327875RB T-DNA repeatrepeat C'repeat Crepeat Brepeat B3' sequence of the ornithine cyclodeaminase gene ocd (non-functional)oricompared to GenBank Accession Number J01749bomresolvasepalindromic sequencepVS1 StaAidentical to the korB operator binding site of plasmid RK2 (Pansegrau et al. 1994, J. Mol. Biol. 239: 623-663); GenBank Accession Number L27758pVS1 RepApalindromic sequencepVS1 oriVrepeat Erepeat ESmRpalindromic sequence; putative termination signalcompared to GenBank Accession Number X00493; removed to destroy a KpnI restriction siteLB T-DNA repeat

pLH9000 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_28262        9154 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Binary vector pLH9000, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1482 to 1583)
  AUTHORS   Hausmann L, Toepfer R.
  TITLE     Development of Plasmid Vectors
  JOURNAL   (in) Brauer,D., Roebbelen,G. and Toepfer,R. (Eds.); BIOENGINEERING 
            OF CUSTOM-TAILORED RAPE VARIETIES: 155-172; Gesellschaft fuer 
            Pflanzenzuechtung e. V., Von Sieboldstr. 8, Goettingen, Germany 
            (1999)
REFERENCE   2  (bases 1 to 9154)
  AUTHORS   Hausmann L, Toepfer R.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2001) Institute for Grapevine Breeding 
            Geilweilerhof, Siebeldingen 76833, Germany
REFERENCE   3  (bases 1 to 9154)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9154)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "(in) 
            Brauer,D., Roebbelen,G. and Toepfer,R. (Eds.)"; volume: " 
            BIOENGINEERING OF CUSTOM-TAILORED RAPE VARIETIES"; pages: " 155-172;
            Gesellschaft fuer Pflanzenzuechtung e. V., Von Sieboldstr. 8, 
            Goettingen, Germany (1999"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (11-DEC-2001) Institute for Grapevine Breeding Geilweilerhof, 
            Siebeldingen 76833, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9154
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        80..424
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     CDS             439..1239
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase from Tn5"
     regulatory      1256..1455
                     /note="terminator sequence from the 35S gene of Cauliflower
                     mosaic virus; GenBank Accession Number: X05868, M31331"
                     /regulatory_class="terminator"
     misc_difference 1289
                     /label=compared to GenBank Accession Number X05868
                     /note="compared to GenBank Accession Number X05868"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      1421..1436
                     /regulatory_class="polyA_signal_sequence"
     misc_feature    1451
                     /label=putative transcription stop site
                     /note="putative transcription stop site"
     misc_feature    1482..1583
                     /note="multiple cloning site from vector pBlueSfi BA;
                     GenBank Accession Number: AF327875"
                     /citation=[1]
     regulatory      1489..1498
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     misc_difference 1609
                     /replace="a"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    1628..1652
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     repeat_region   1676..1688
                     /label=repeat C'
                     /note="repeat C'"
     misc_difference 1682
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     repeat_region   1711..1722
                     /label=repeat C
                     /note="repeat C"
     repeat_region   1736..1746
                     /label=repeat B
                     /note="repeat B"
     repeat_region   1763..1773
                     /label=repeat B
                     /note="repeat B"
     misc_difference 1768
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_difference 1779
                     /replace="a"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    1796..2186
                     /note="3' sequence of the ornithine cyclodeaminase gene ocd
                     (non-functional)"
     misc_difference 1972
                     /replace="t"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     rep_origin      2297..2885
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_difference 2983..2984
                     /replace="gta"
                     /label=compared to GenBank Accession Number J01749
                     /note="compared to GenBank Accession Number J01749"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    complement(3070..3210)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     regulatory      3498..3503
                     /regulatory_class="minus_35_signal"
     regulatory      3524..3529
                     /regulatory_class="minus_10_signal"
     regulatory      3546..3550
                     /regulatory_class="ribosome_binding_site"
     CDS             3560..4246
                     /codon_start=1
                     /product="resolvase"
                     /label=resolvase
                     /note="resolvase-like protein encoded by parR of plasmid
                     pVS1; similar to Tn3 resolvase (GenBank Accession Number 
                     V00613), Tn917 resolvase (GenBank Accession Number M11180) 
                     and ParA (RK2) (GenBank Accession Number L27758)"
                     /protein_id="AAL78961.1"
                     /translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT
                     RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT
                     TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI
                     DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE
                     RQEEQA"
     misc_difference 3979
                     /replace="c"
                     /note="original nucleotide changed to destroy a SfiI
                     restriction site"
                     /experiment="experimental evidence, no additional details
                     recorded"
     stem_loop       4390..4422
                     /label=palindromic sequence
                     /note="palindromic sequence"
     misc_difference 4398
                     /replace="g"
                     /note="nucleotide changed to conserve palindromic sequence 
                     following SfiI restriction site-destruction"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_difference 4413
                     /replace="c"
                     /note="original nucleotide changed to destroy two SfiI 
                     restriction sites"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      4480..4485
                     /regulatory_class="minus_35_signal"
     regulatory      4501..4506
                     /regulatory_class="minus_10_signal"
     regulatory      4534..4541
                     /regulatory_class="ribosome_binding_site"
     CDS             4545..5171
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     misc_feature    5441..5453
                     /note="identical to the korB operator binding site of
                     plasmid RK2 (Pansegrau et al. 1994, J. Mol. Biol. 239: 
                     623-663); GenBank Accession Number L27758"
     CDS             5603..6673
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     stem_loop       6690..6712
                     /label=palindromic sequence
                     /note="palindromic sequence"
     rep_origin      6742..6936
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     repeat_region   7033..7039
                     /label=repeat E
                     /note="repeat E"
     repeat_region   7040..7046
                     /label=repeat E
                     /note="repeat E"
     regulatory      7277..7282
                     /regulatory_class="minus_35_signal"
     regulatory      7300..7305
                     /regulatory_class="minus_10_signal"
     CDS             7541..8329
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     stem_loop       8335..8392
                     /note="palindromic sequence; putative termination signal"
     misc_difference 8569..8570
                     /replace="ggtacc"
                     /note="compared to GenBank Accession Number X00493; removed
                     to destroy a KpnI restriction site"
     misc_feature    8852..8876
                     /label=LB T-DNA repeat
                     /note="left border repeat from octopine Ach5 T-DNA"

This page is informational only.