Basic Vector Information
- Vector Name:
- pLH7000
- Antibiotic Resistance:
- Streptomycin
- Length:
- 8911 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Hausmann L, Toepfer R.
- Promoter:
- CaMV 35S
pLH7000 vector Map
pLH7000 vector Sequence
LOCUS 40924_28252 8911 bp DNA circular SYN 18-DEC-2018 DEFINITION Binary vector pLH7000, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8911) AUTHORS Hausmann L, Toepfer R. TITLE Development of Plasmid Vectors JOURNAL (in) Brauer,D., Roebbelen,G. and Toepfer,R. (Eds.); BIOENGINEERING OF CUSTOM-TAILORED RAPE VARIETIES: 155-172; GPZ e. V., Von Sieboldstr. 8, Goettingen, Germany (1999) REFERENCE 2 (bases 1 to 8911) AUTHORS Hausmann L, Toepfer R. TITLE Direct Submission JOURNAL Submitted (12-FEB-2003) Institute for Grapevine Breeding Geilweilerhof, Siebeldingen 76833, Germany REFERENCE 3 (bases 1 to 8911) TITLE Direct Submission REFERENCE 4 (bases 1 to 8911) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "(in) Brauer,D., Roebbelen,G. and Toepfer,R. (Eds.)"; volume: " BIOENGINEERING OF CUSTOM-TAILORED RAPE VARIETIES"; pages: " 155-172; GPZ e. V., Von Sieboldstr. 8, Goettingen, Germany (1999" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-FEB-2003) Institute for Grapevine Breeding Geilweilerhof, Siebeldingen 76833, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8911 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 80..424 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" CDS 439..987 /label=BlpR /note="phosphinothricin acetyltransferase" regulatory 1013..1212 /note="terminator sequence from the 35S gene of Cauliflower mosaic virus in GenBank Accession Numbers X05868 and V00140" /regulatory_class="terminator" misc_difference 1051 /label=compared to GenBank Accession Number X05868 /note="compared to GenBank Accession Number X05868" /experiment="experimental evidence, no additional details recorded" regulatory 1178..1193 /regulatory_class="polyA_signal_sequence" misc_feature 1208 /label=putative transcription stop site /note="putative transcription stop site" misc_feature 1239..1340 /note="multiple cloning site from vector pBlueSfi BA in GenBank Accession Number AF327875" regulatory 1246..1255 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" misc_difference 1366 /replace="a" /label=compared to GenBank Accession Number X07435 /note="compared to GenBank Accession Number X07435" /experiment="experimental evidence, no additional details recorded" misc_feature 1385..1409 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" repeat_region 1433..1445 /label=repeat C' /note="repeat C'" misc_difference 1439 /label=compared to GenBank Accession Number X07435 /note="compared to GenBank Accession Number X07435" /experiment="experimental evidence, no additional details recorded" repeat_region 1468..1479 /label=repeat C /note="repeat C" repeat_region 1493..1503 /label=repeat B /note="repeat B" repeat_region 1520..1530 /label=repeat B /note="repeat B" misc_difference 1525 /label=compared to GenBank Accession Number X07435 /note="compared to GenBank Accession Number X07435" /experiment="experimental evidence, no additional details recorded" misc_difference 1536 /replace="a" /label=compared to GenBank Accession Number X07435 /note="compared to GenBank Accession Number X07435" /experiment="experimental evidence, no additional details recorded" misc_feature complement(1553..1943) /note="3' sequence of the ornithine cyclodeaminase gene ocd; non-functional" misc_difference 1729 /replace="t" /label=compared to GenBank Accession Number X07435 /note="compared to GenBank Accession Number X07435" /experiment="experimental evidence, no additional details recorded" rep_origin 2054..2642 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_difference 2740..2741 /replace="gta" /label=compared to GenBank Accession Number J01749 /note="compared to GenBank Accession Number J01749" /experiment="experimental evidence, no additional details recorded" misc_feature complement(2827..2967) /label=bom /note="basis of mobility region from pBR322" regulatory 3255..3260 /regulatory_class="minus_35_signal" regulatory 3281..3286 /regulatory_class="minus_10_signal" regulatory 3303..3307 /regulatory_class="ribosome_binding_site" CDS 3317..4003 /codon_start=1 /product="resolvase" /label=resolvase /note="resolvase-like protein encoded by parR of plasmid pVS1; similar to Tn3 resolvase in GenBank Accession Number V00613, Tn917 resolvase in GenBank Accession Number M11180, and RK2 ParA in GenBank Accession Number L27758" /protein_id="AAO85361.1" /translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE RQEEQA" misc_difference 3736 /replace="c" /note="original nucleotide changed to destroy a SfiI restriction site" /experiment="experimental evidence, no additional details recorded" stem_loop 4147..4179 /label=palindromic sequence /note="palindromic sequence" misc_difference 4155 /replace="g" /note="nucleotide changed to conserve palindromic sequence following SfiI restriction site-destruction" /experiment="experimental evidence, no additional details recorded" misc_difference 4170 /replace="c" /note="original nucleotide changed to destroy two SfiI restriction sites" /experiment="experimental evidence, no additional details recorded" regulatory 4237..4242 /regulatory_class="minus_35_signal" regulatory 4258..4263 /regulatory_class="minus_10_signal" regulatory 4291..4298 /regulatory_class="ribosome_binding_site" CDS 4302..4928 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 5198..5210 /note="identical to the korB operator binding site of plasmid RK2 in GenBank Accession Number L27758.1" CDS 5360..6430 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" stem_loop 6447..6469 /label=palindromic sequence /note="palindromic sequence" rep_origin 6499..6693 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" repeat_region 6790..6803 /label=repeat E /rpt_unit_range=6790 .. 6796 /note="repeat E" regulatory 7034..7039 /regulatory_class="minus_35_signal" regulatory 7057..7062 /regulatory_class="minus_10_signal" CDS 7298..8086 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" stem_loop 8092..8149 /note="palindromic sequence; putative termination signal" misc_difference 8326..8327 /replace="ggtacc" /note="compared to GenBank Accession Number X00493; removed to destroy a KpnI restriction site" misc_feature 8609..8633 /label=LB T-DNA repeat /note="left border repeat from octopine Ach5 T-DNA"
This page is informational only.