pLH6500 vector (V005003)

Download GeneBank File(.gb)

LOCUS       40924_28247        9393 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Binary vector pLH6500, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9393)
  AUTHORS   Hausmann L, Toepfer R.
  TITLE     Development of Plasmid Vectors
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 9393)
  AUTHORS   Hausmann L, Toepfer R.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2003) Institute for Grapevine Breeding 
            Geilweilerhof, Siebeldingen 76833, Germany
REFERENCE   3  (bases 1 to 9393)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9393)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (12-FEB-2003) Institute for Grapevine Breeding Geilweilerhof, 
            Siebeldingen 76833, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9393
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        80..424
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     misc_difference 447
                     /gene="hph"
                     /gene_synonym="hpt; hyg"
                     /replace="g"
                     /label=compared to GenBank accesion Number K01193
                     /note="compared to GenBank accesion Number K01193"
     CDS             452..1474
                     /label=HygR
                     /note="aminoglycoside phosphotransferase from E. coli"
     regulatory      1503..1702
                     /note="terminator sequence from the 35S gene of Cauliflower
                     mosaic virus in GenBank Accession Numbers X05868 and 
                     V00140"
                     /regulatory_class="terminator"
     misc_difference 1541
                     /label=compared to GenBank Accession Number X05868
                     /note="compared to GenBank Accession Number X05868"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      1668..1683
                     /regulatory_class="polyA_signal_sequence"
     misc_feature    1698
                     /label=putative transcription stop site
                     /note="putative transcription stop site"
     misc_feature    1721..1822
                     /note="multiple cloning site from vector pBlueSfi AB in
                     GenBank Accession Number AF327874"
     regulatory      1792..1801
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     misc_difference 1848
                     /replace="a"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    1867..1891
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     repeat_region   1915..1927
                     /label=repeat C'
                     /note="repeat C'"
     misc_difference 1921
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     repeat_region   1950..1961
                     /label=repeat C
                     /note="repeat C"
     repeat_region   1975..1985
                     /label=repeat B
                     /note="repeat B"
     repeat_region   2002..2012
                     /label=repeat B
                     /note="repeat B"
     misc_difference 2007
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_difference 2018
                     /replace="a"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    complement(2035..2425)
                     /note="3' sequence of the ornithine cyclodeaminase gene
                     ocd; non-functional"
     misc_difference 2211
                     /replace="t"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     rep_origin      2536..3124
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_difference 3222..3223
                     /replace="gta"
                     /label=compared to GenBank Accession Number J01749
                     /note="compared to GenBank Accession Number J01749"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    complement(3309..3449)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     regulatory      3737..3742
                     /regulatory_class="minus_35_signal"
     regulatory      3763..3768
                     /regulatory_class="minus_10_signal"
     regulatory      3785..3789
                     /regulatory_class="ribosome_binding_site"
     CDS             3799..4485
                     /codon_start=1
                     /product="resolvase"
                     /label=resolvase
                     /note="resolvase-like protein encoded by parR of plasmid
                     pVS1; similar to Tn3 resolvase in GenBank Accession Number 
                     V00613, Tn917 resolvase in GenBank Accession Number M11180,
                     and RK2 ParA in GenBank Accession Number L27758"
                     /protein_id="AAO85356.1"
                     /translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT
                     RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT
                     TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI
                     DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE
                     RQEEQA"
     misc_difference 4218
                     /replace="c"
                     /note="original nucleotide changed to destroy a SfiI
                     restriction site"
                     /experiment="experimental evidence, no additional details
                     recorded"
     stem_loop       4629..4661
                     /label=palindromic sequence
                     /note="palindromic sequence"
     misc_difference 4637
                     /replace="g"
                     /note="nucleotide changed to conserve palindromic sequence 
                     following SfiI restriction site-destruction"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_difference 4652
                     /replace="c"
                     /note="original nucleotide changed to destroy two SfiI 
                     restriction sites"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      4719..4724
                     /regulatory_class="minus_35_signal"
     regulatory      4740..4745
                     /regulatory_class="minus_10_signal"
     regulatory      4773..4780
                     /regulatory_class="ribosome_binding_site"
     CDS             4784..5410
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     misc_feature    5680..5692
                     /note="identical to the korB operator binding site of
                     plasmid RK2 in GenBank Accession Number L27758.1"
     CDS             5842..6912
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     stem_loop       6929..6951
                     /label=palindromic sequence
                     /note="palindromic sequence"
     rep_origin      6981..7175
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     repeat_region   7272..7285
                     /label=repeat E
                     /rpt_unit_range=7272 .. 7278
                     /note="repeat E"
     regulatory      7516..7521
                     /regulatory_class="minus_35_signal"
     regulatory      7539..7544
                     /regulatory_class="minus_10_signal"
     CDS             7780..8568
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     stem_loop       8574..8631
                     /note="palindromic sequence; putative termination signal"
     misc_difference 8808..8809
                     /replace="ggtacc"
                     /note="compared to GenBank Accession Number X00493; removed
                     to destroy a KpnI restriction site"
     misc_feature    9091..9115
                     /label=LB T-DNA repeat
                     /note="left border repeat from octopine Ach5 T-DNA"