pLH6000 vector (V005004)

Basic Vector Information

Vector Name:
pLH6000
Antibiotic Resistance:
Streptomycin
Length:
9401 bp
Type:
Binary vector
Replication origin:
ori
Host:
Plants
Source/Author:
Hausmann L, Toepfer R.
Promoter:
CaMV 35S

pLH6000 vector Map

pLH60009401 bp400800120016002000240028003200360040004400480052005600600064006800720076008000840088009200CaMV 35S promoterhphHygRterminator sequence from the 35S gene of Cauliflower mosaic virus in GenBank Accession Numbers X05868 and V00140multiple cloning site from vector pBlueSfi BA in GenBank Accession Number AF327875compared to GenBank Accession Number X07435RB T-DNA repeatrepeat C'repeat Crepeat Brepeat Bcompared to GenBank Accession Number X074353' sequence of the ornithine cyclodeaminase gene ocd; non-functionaloricompared to GenBank Accession Number J01749bomregulatoryregulatoryregulatoryresolvasepalindromic sequenceregulatoryregulatoryregulatorypVS1 StaAidentical to the korB operator binding site of plasmid RK2 in GenBank Accession Number L27758.1pVS1 RepApalindromic sequencepVS1 oriVrepeat EregulatoryregulatorySmRpalindromic sequence; putative termination signalcompared to GenBank Accession Number X00493; removed to destroy a KpnI restriction siteLB T-DNA repeat

pLH6000 vector Sequence

LOCUS       40924_28242        9401 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Binary vector pLH6000, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9401)
  AUTHORS   Hausmann L, Toepfer R.
  TITLE     Development of Plasmid Vectors
  JOURNAL   (in) Brauer,D., Roebbelen,G. and Toepfer,R. (Eds.); BIOENGINEERING 
            OF CUSTOM-TAILORED RAPE VARIETIES: 155-172; GPZ e. V., Von 
            Sieboldstr. 8, Goettingen, Germany (1999)
REFERENCE   2  (bases 1 to 9401)
  AUTHORS   Hausmann L, Toepfer R.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2003) Institute for Grapevine Breeding 
            Geilweilerhof, Siebeldingen 76833, Germany
REFERENCE   3  (bases 1 to 9401)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9401)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "(in) 
            Brauer,D., Roebbelen,G. and Toepfer,R. (Eds.)"; volume: " 
            BIOENGINEERING OF CUSTOM-TAILORED RAPE VARIETIES"; pages: " 155-172;
            GPZ e. V., Von Sieboldstr. 8, Goettingen, Germany (1999"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (12-FEB-2003) Institute for Grapevine Breeding Geilweilerhof, 
            Siebeldingen 76833, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9401
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        80..424
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     misc_difference 447
                     /gene="hph"
                     /gene_synonym="hpt; hyg"
                     /replace="g"
                     /label=compared to GenBank accesion Number K01193
                     /note="compared to GenBank accesion Number K01193"
     CDS             452..1474
                     /label=HygR
                     /note="aminoglycoside phosphotransferase from E. coli"
     regulatory      1503..1702
                     /note="terminator sequence from the 35S gene of Cauliflower
                     mosaic virus in GenBank Accession Numbers X05868 and 
                     V00140"
                     /regulatory_class="terminator"
     misc_difference 1541
                     /label=compared to GenBank Accession Number X05868
                     /note="compared to GenBank Accession Number X05868"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      1668..1683
                     /regulatory_class="polyA_signal_sequence"
     misc_feature    1698
                     /label=putative transcription stop site
                     /note="putative transcription stop site"
     misc_feature    1729..1830
                     /note="multiple cloning site from vector pBlueSfi BA in
                     GenBank Accession Number AF327875"
     regulatory      1736..1745
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     misc_difference 1856
                     /replace="a"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    1875..1899
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     repeat_region   1923..1935
                     /label=repeat C'
                     /note="repeat C'"
     misc_difference 1929
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     repeat_region   1958..1969
                     /label=repeat C
                     /note="repeat C"
     repeat_region   1983..1993
                     /label=repeat B
                     /note="repeat B"
     repeat_region   2010..2020
                     /label=repeat B
                     /note="repeat B"
     misc_difference 2015
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_difference 2026
                     /replace="a"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    complement(2043..2433)
                     /note="3' sequence of the ornithine cyclodeaminase gene
                     ocd; non-functional"
     misc_difference 2219
                     /replace="t"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     rep_origin      2544..3132
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_difference 3230..3231
                     /replace="gta"
                     /label=compared to GenBank Accession Number J01749
                     /note="compared to GenBank Accession Number J01749"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    complement(3317..3457)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     regulatory      3745..3750
                     /regulatory_class="minus_35_signal"
     regulatory      3771..3776
                     /regulatory_class="minus_10_signal"
     regulatory      3793..3797
                     /regulatory_class="ribosome_binding_site"
     CDS             3807..4493
                     /codon_start=1
                     /product="resolvase"
                     /label=resolvase
                     /note="resolvase-like protein encoded by parR of plasmid
                     pVS1; similar to Tn3 resolvase in GenBank Accession Number 
                     V00613, Tn917 resolvase in GenBank Accession Number M11180,
                     and RK2 ParA in GenBank Accession Number L27758"
                     /protein_id="AAO85351.1"
                     /translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT
                     RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT
                     TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI
                     DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE
                     RQEEQA"
     misc_difference 4226
                     /replace="c"
                     /note="original nucleotide changed to destroy a SfiI
                     restriction site"
                     /experiment="experimental evidence, no additional details
                     recorded"
     stem_loop       4637..4669
                     /label=palindromic sequence
                     /note="palindromic sequence"
     misc_difference 4645
                     /replace="g"
                     /note="nucleotide changed to conserve palindromic sequence 
                     following SfiI restriction site-destruction"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_difference 4660
                     /replace="c"
                     /note="original nucleotide changed to destroy two SfiI 
                     restriction sites"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      4727..4732
                     /regulatory_class="minus_35_signal"
     regulatory      4748..4753
                     /regulatory_class="minus_10_signal"
     regulatory      4781..4788
                     /regulatory_class="ribosome_binding_site"
     CDS             4792..5418
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     misc_feature    5688..5700
                     /note="identical to the korB operator binding site of
                     plasmid RK2 in GenBank Accession Number L27758.1"
     CDS             5850..6920
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     stem_loop       6937..6959
                     /label=palindromic sequence
                     /note="palindromic sequence"
     rep_origin      6989..7183
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     repeat_region   7280..7293
                     /label=repeat E
                     /rpt_unit_range=7280 .. 7286
                     /note="repeat E"
     regulatory      7524..7529
                     /regulatory_class="minus_35_signal"
     regulatory      7547..7552
                     /regulatory_class="minus_10_signal"
     CDS             7788..8576
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     stem_loop       8582..8639
                     /note="palindromic sequence; putative termination signal"
     misc_difference 8816..8817
                     /replace="ggtacc"
                     /note="compared to GenBank Accession Number X00493; removed
                     to destroy a KpnI restriction site"
     misc_feature    9099..9123
                     /label=LB T-DNA repeat
                     /note="left border repeat from octopine Ach5 T-DNA"

This page is informational only.