Basic Vector Information
- Vector Name:
- pLGFP_delta_1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4823 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Kobayashi H.
- Promoter:
- trc
pLGFP_delta_1 vector Map
pLGFP_delta_1 vector Sequence
LOCUS 40924_28197 4823 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pLGFP_delta_1 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4823) AUTHORS Kobayashi H. TITLE Inducible suppression of global translation by overuse of rare codons JOURNAL Appl. Environ. Microbiol. 81 (7), 2544-2553 (2015) PUBMED 25636849 REFERENCE 2 (bases 1 to 4823) AUTHORS Kobayashi H. TITLE Direct Submission JOURNAL Submitted (07-JAN-2015) Contact:Hideki Kobayashi Agency for Marine-Earth Science and Technology, Institute of Biogeosciences; 2-15 Natsushima, Yokosuka, Kanagawa 237-0061, Japan URL :http://www.jamstec.go.jp/j/ REFERENCE 3 (bases 1 to 4823) TITLE Direct Submission REFERENCE 4 (bases 1 to 4823) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2015"; volume: "81"; issue: "7"; pages: "2544-2553" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (07-JAN-2015) Contact:Hideki Kobayashi Agency for Marine-Earth Science and Technology, Institute of Biogeosciences; 2-15 Natsushima, Yokosuka, Kanagawa 237-0061, Japan URL :http://www.jamstec.go.jp/j/" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4823 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(22..1101) /codon_start=1 /label=lacI /note="lac repressor" /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" CDS complement(1317..1382) /codon_start=1 /label=lambda N peptide /note="N-terminal RNA-binding domain from the lambda bacteriophage antiterminator protein N (Baron-Benhamou et al., 2004)" /translation="MDAQTRRRERRAEKQAQWKAAN" promoter 1723..1752 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 1760..1776 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 1796..2332 /codon_start=1 /gene="lgfp_delta_1" /product="GFP deletion mutant" /label=lgfp_delta_1 /protein_id="BAQ25560.1" /translation="MSKGEELFTGVVPILVELDGDVNGQKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFYKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMADKPKNGIKV NFKIRHNIKDGSVQL" gene 1796..2332 /gene="lgfp_delta_1" /label=lgfp_delta_1 terminator 2543..2629 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2721..2748 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 2768..2859 /label=AmpR promoter CDS 2860..3717 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPTAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" terminator 3750..3844 /label=lambda t0 terminator /note="transcription terminator from phage lambda" rep_origin 3932..4520 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(4684..4770) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.