Basic Vector Information
- Vector Name:
- pLGFPm
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4996 bp
- Type:
- Expression vector
- Replication origin:
- p15A ori
- Source/Author:
- Kobayashi H.
- Promoter:
- trc
pLGFPm vector Map
pLGFPm vector Sequence
LOCUS 40924_28192 4996 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pLGFPm DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4996) AUTHORS Kobayashi H. TITLE Inducible suppression of global translation by overuse of rare codons JOURNAL Appl. Environ. Microbiol. 81 (7), 2544-2553 (2015) PUBMED 25636849 REFERENCE 2 (bases 1 to 4996) AUTHORS Kobayashi H. TITLE Direct Submission JOURNAL Submitted (07-JAN-2015) Contact:Hideki Kobayashi Agency for Marine-Earth Science and Technology, Institute of Biogeosciences; 2-15 Natsushima, Yokosuka, Kanagawa 237-0061, Japan URL :http://www.jamstec.go.jp/j/ REFERENCE 3 (bases 1 to 4996) TITLE Direct Submission REFERENCE 4 (bases 1 to 4996) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2015"; volume: "81"; issue: "7"; pages: "2544-2553" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (07-JAN-2015) Contact:Hideki Kobayashi Agency for Marine-Earth Science and Technology, Institute of Biogeosciences; 2-15 Natsushima, Yokosuka, Kanagawa 237-0061, Japan URL :http://www.jamstec.go.jp/j/" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4996 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(22..1101) /codon_start=1 /label=lacI /note="lac repressor" /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" CDS complement(1317..1382) /codon_start=1 /label=lambda N peptide /note="N-terminal RNA-binding domain from the lambda bacteriophage antiterminator protein N (Baron-Benhamou et al., 2004)" /translation="MDAQTRRRERRAEKQAQWKAAN" promoter 1723..1752 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 1760..1776 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 1796..2509 /codon_start=1 /label=yeGFP /note="yeast-enhanced green fluorescent protein" /translation="MSKGEELFTGVVPILVELDGDVNGQKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFYKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMADKPKNGIKV NFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLE FVTAAGITHGMDELYK" terminator 2723..2809 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2901..2928 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 2948..3039 /label=AmpR promoter CDS 3040..3897 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPTAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" terminator 3930..4024 /label=lambda t0 terminator /note="transcription terminator from phage lambda" rep_origin 4138..4687 /direction=RIGHT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." terminator complement(4857..4943) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.