Basic Vector Information
- Vector Name:
- pLeo665
- Length:
- 3400 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Scheller L, Strittmatter T, Fuchs D, Bojar D, Fussenegger M.
pLeo665 vector Map
pLeo665 vector Sequence
LOCUS 40924_28092 3400 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pLeo665, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3400) AUTHORS Scheller L, Strittmatter T, Fuchs D, Bojar D, Fussenegger M. TITLE Generalized extracellular molecule sensor platform for programming cellular behavior JOURNAL Nat. Chem. Biol. 14 (7), 723-729 (2018) PUBMED 29686358 REFERENCE 2 (bases 1 to 3400) AUTHORS Scheller L, Strittmatter T. TITLE Direct Submission JOURNAL Submitted (06-NOV-2017) D-BSSE, ETH Zurich, Mattenstrasse 26, Basel 4058, Switzerland REFERENCE 3 (bases 1 to 3400) TITLE Direct Submission REFERENCE 4 (bases 1 to 3400) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem. Biol."; date: "2018"; volume: "14"; issue: "7"; pages: "723-729" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-NOV-2017) D-BSSE, ETH Zurich, Mattenstrasse 26, Basel 4058, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3400 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 15..285 /label=tetracycline response element /note="contains seven copies of the tetracycline operator tetO" misc_feature 318..442 /label=CMVmin /note="CMVmin" promoter 318..355 /label=minimal CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" sig_peptide 467..526 /label=Ig-kappa leader /note="leader sequence from mouse immunoglobulin kappa light chain" CDS 545..1057 /codon_start=1 /label=Nluc /note="NanoLuc(R) luciferase" /translation="MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQR IVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGV TPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGW RLCERILA" polyA_signal complement(1087..1221) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1583..2171) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2638..3016) /label=ISS /note="immunostimulatory sequence from the AmpR gene; contains unmethylated CpG dinucleotides in the context of 5'-AACGTT-3' (Sato et al., 1996)" promoter complement(3201..3305) /label=AmpR promoter
This page is informational only.