Basic Vector Information
- Vector Name:
- pLC291
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7506 bp
- Type:
- Expression vector
- Replication origin:
- oriV
- Source/Author:
- Chubiz LM, Purswani J, Carroll SM, Marx CJ.
pLC291 vector Map
pLC291 vector Sequence
LOCUS 40924_27593 7506 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pLC291, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7506) AUTHORS Chubiz LM, Purswani J, Carroll SM, Marx CJ. TITLE A novel pair of inducible expression vectors for use in Methylobacterium extorquens JOURNAL BMC Res Notes 6, 183 (2013) PUBMED 23648175 REFERENCE 2 (bases 1 to 7506) AUTHORS Chubiz LM, Purswani J, Marx CJ. TITLE A novel set of broad-host, inducible expression vectors for use in Methylobacterium extorquens and other gram-negative bacteria JOURNAL Unpublished REFERENCE 3 (bases 1 to 7506) AUTHORS Chubiz LM, Purswani J, Marx CJ. TITLE Direct Submission JOURNAL Submitted (10-DEC-2012) Organsmic and Evolutionary Biology, Harvard University, 16 Divinity Ave., Cambridge, MA 02138, USA REFERENCE 4 (bases 1 to 7506) TITLE Direct Submission REFERENCE 5 (bases 1 to 7506) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BMC Res Notes 6, 183 (2013)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (10-DEC-2012) Organsmic and Evolutionary Biology, Harvard University, 16 Divinity Ave., Cambridge, MA 02138, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..7506 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 3..712 /label=oriV /note="incP origin of replication" rep_origin 1105..1693 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 1981..2002 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2017..2047 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2055..2071 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 2079..2095 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 2131..2754 /codon_start=1 /label=TetR /note="tetracycline repressor TetR" /translation="MMSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWH VKNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGT RPTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPT TDSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGS" primer_bind 2801..2817 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" terminator 2999..3085 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 3177..3204 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" misc_feature 3281..3362 /label=pR /note="pR" protein_bind 3370..3388 /label=tet operator /note="bacterial operator O2 for the tetR and tetA genes" CDS complement(3947..4759) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" CDS complement(5434..6579) /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" CDS complement(6851..7222) /codon_start=1 /gene="traJ" /product="oriT-recognizing protein" /label=traJ /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSL*AYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" oriT complement(7255..7364) /direction=LEFT /label=oriT /note="incP origin of transfer"
This page is informational only.