Basic Vector Information
- Vector Name:
- pLACT7
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4779 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Chong S, Garcia GA.
pLACT7 vector Map
pLACT7 vector Sequence
LOCUS 40924_27543 4779 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pLACT7, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4779) AUTHORS Chong S, Garcia GA. TITLE A versatile and general prokaryotic expression vector, pLACT7 JOURNAL BioTechniques 17 (4), 686-681 (1994) PUBMED 7833029 REFERENCE 2 (bases 1 to 4779) AUTHORS Garcia GA. TITLE Direct Submission JOURNAL Submitted (28-OCT-1994) George A. Garcia, College of Pharmacy, University of Michigan, 428 Church St., Ann Arbor, MI 48109-1065 REFERENCE 3 (bases 1 to 4779) TITLE Direct Submission REFERENCE 4 (bases 1 to 4779) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BioTechniques"; date: "1994"; volume: "17"; issue: "4"; pages: "686-681" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-OCT-1994) George A. Garcia, College of Pharmacy, University of Michigan, 428 Church St., Ann Arbor, MI 48109-1065" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4779 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 149..165 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" terminator complement(174..221) /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS complement(254..286) /codon_start=1 /label=T7 tag (gene 10 leader) /note="leader peptide from bacteriophage T7 gene 10" /translation="MASMTGGQQMG" promoter complement(310..328) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(342..358) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(366..382) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(390..420) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(435..456) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 981..1058 /label=lacI promoter CDS 1059..2138 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 2154..2175 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2580..3168) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3342..4199) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(4200..4304) /label=AmpR promoter rep_origin complement(join(4331..4779,1..7)) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis"
This page is informational only.