pLac-GFP vector (V005086)

Price Information

Cat No. Plasmid Name Availability Add to cart
V005086 pLac-GFP In stock, instant shipping

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

The pLac-GFP construct constitutively expresses GFP and serves as a control throughout

Vector Name:
pLac-GFP
Antibiotic Resistance:
Ampicillin
Length:
6465 bp
Type:
Cloning vector
Replication origin:
ori
Source/Author:
Swofford CA, Van Dessel N, Forbes NS.
Promoter:
lac
Growth Strain(s):
Top 10
Growth Temperature:
37℃

pLac-GFP vector Vector Map

pLac-GFP6465 bp300600900120015001800210024002700300033003600390042004500480051005400570060006300CAP binding sitelac promoterlac operatorM13 revyeGFPRSF1010 oriTDNA primaseoriAmpRAmpR promoterAspartate-semialdehyde dehydrogenase

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Swofford CA, Van Dessel N, Forbes NS. Quorum-sensing Salmonella selectively trigger protein expression within tumors. Proc Natl Acad Sci U S A. 2015 Mar 17;112(11):3457-62.

pLac-GFP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       V005086                 6465 bp    DNA     circular SYN 31-AUG-2023
DEFINITION  Exported.
ACCESSION   V005086
VERSION     V005086
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6465)
  AUTHORS   Swofford CA, Van Dessel N, Forbes NS.
  TITLE     Quorum-sensing Salmonella selectively trigger protein expression
            within tumors
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 112 (11), 3457-3462 (2015)
   PUBMED   25737556
REFERENCE   2  (bases 1 to 6465)
  AUTHORS   Swofford CA, Van Dessel N, Forbes NS.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-DEC-2014) Chemical Engineering, University of
            Massachusetts Amherst, 686 North Pleasant Street, Amherst, MA
            01003-9303, USA
REFERENCE   3  (bases 1 to 6465)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6465)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
            Acad. Sci. U.S.A."; date: "2015"; volume: "112"; issue: "11"; pages:
            "3457-3462"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (18-DEC-2014) Chemical Engineering, University of Massachusetts
            Amherst, 686 North Pleasant Street, Amherst, MA 01003-9303, USA"
            SGRef: number: 3; type: "Journal Article"
            SGRef: number: 1; type: ""Journal Article""; journalName: ""Proc.
            Natl. Acad. Sci. U.S.A.""; date: ""2015""; volume: ""112""; issue:
            ""11""; pages: ""3457-3462""
            SGRef: number: 2; type: ""Journal Article""; journalName:
            ""Submitted (18-DEC-2014) Chemical Engineering, University of
            Massachusetts Amherst, 686 North Pleasant Street, Amherst, MA
            01003-9303, USA"" SGRef: number: 3; type: ""Journal Article""
FEATURES             Location/Qualifiers
     source          1..6465
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    133..154
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        169..199
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    207..223
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     231..247
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             275..988
                     /label="yeGFP"
                     /note="yeast-enhanced green fluorescent protein"
     oriT            1615..1702
                     /label="RSF1010 oriT"
                     /note="origin of transfer of the broad-host-range plasmid
                     RSF1010 (Scholz et al., 1989)"
     CDS             1783..3132
                     /codon_start=1
                     /label="DNA primase"
                     /translation="MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVLHAESG
                     HMPEFVERPADYWDAADLYERANGRLFKEVEFALPVELTLDQQKALASEFAQHLTGAER
                     LPYTLAIHAGGGENPHCHLMISERINDGIERPAAQWFKRYNGKTPEKGGAQKTEALKPK
                     AWLEQTREAWADHANRALERAGHDARIDHRTLEAQGIERLPGVHLGPNVVEMEGRGIRT
                     DRADVALNIDTANAQIIDLQEYREAIDHERNRQSEEIQRHQRVSGADRTAGPEHGDTGR
                     RSPAGHEPDPAGQRGAGGGVAESPAPDRGGMGGAGQRVAGGSRRGEQRRAERPERVAGV
                     ALEAMANRDAGFHDAYGGAADRIVALARPDATDNRGRLDLAALGGPMKNDRTLQAIGRQ
                     LKAMGCERSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM"
     rep_origin      complement(3186..3774)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(3948..4805)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(4806..4910)
                     /label="AmpR promoter"
     CDS             complement(5090..6193)
                     /gene="asd"
                     /label="Aspartate-semialdehyde dehydrogenase"
                     /note="Aspartate-semialdehyde dehydrogenase from Salmonella
                     typhimurium (strain LT2 / SGSC1412 / ATCC 700720).
                     Accession#: P0A1F8"