Basic Vector Information
- Vector Name:
- pL1E-lc
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4472 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hochrein L, Machens F, Gremmels J, Schulz K, Messerschmidt K, Mueller-Roeber B.
- Promoter:
- SNR52
pL1E-lc vector Map
pL1E-lc vector Sequence
LOCUS 40924_27464 4472 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pL1E-lc, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4472) AUTHORS Hochrein L, Machens F, Gremmels J, Schulz K, Messerschmidt K, Mueller-Roeber B. TITLE AssemblX: a user-friendly toolkit for rapid and reliable multi-gene assemblies JOURNAL Nucleic Acids Res. (2017) In press PUBMED 28130422 REFERENCE 2 (bases 1 to 4472) AUTHORS Hochrein L, Machens F, Gremmels J, Schulz K, Messerschmidt K, Mueller-Roeber B. TITLE Direct Submission JOURNAL Submitted (11-NOV-2016) Department of Molecular Biology - Cell2Fab research unit, University of Potsdam, Karl-Liebknecht-Str. 24-25, Potsdam, Brandenburg 14476, Germany REFERENCE 3 (bases 1 to 4472) TITLE Direct Submission REFERENCE 4 (bases 1 to 4472) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2017) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-NOV-2016) Department of Molecular Biology - Cell2Fab research unit, University of Potsdam, Karl-Liebknecht-Str. 24-25, Potsdam, Brandenburg 14476, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4472 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(64..652) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(826..1683) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCDTLLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDESDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKRSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" misc_feature complement(1781..2284) /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" promoter 2545..2813 /label=SNR52 promoter /note="promoter for the S. cerevisiae small nucleolar RNA gene SNR52" misc_RNA 2822..2896 /label=gRNA scaffold /note="guide RNA scaffold for the Streptococcus pyogenes CRISPR/Cas9 system" terminator 2901..2920 /label=SUP4 terminator /note="transcription terminator for the S. cerevisiae SUP4 tRNA gene" terminator 2972..3161 /label=CYC1 terminator /note="transcription terminator for CYC1" misc_feature 3380..3397 /label=I-SceI /note="I-SceI" misc_feature 3398..3447 /label=homology region E0* /note="homology region E0*" CDS 3456..4127 /codon_start=1 /label=TRP1 /note="phosphoribosylanthranilate isomerase, required for tryptophan biosynthesis" /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA KK" misc_feature 4227..4276 /label=homology region F0* /note="homology region F0*" misc_feature 4277..4294 /label=I-SceI /note="I-SceI"
This page is informational only.