Basic Vector Information
- Vector Name:
- pKZ2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8030 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Wu Z.
pKZ2 vector Vector Map
pKZ2 vector Sequence
LOCUS V005159 8030 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V005159 VERSION V005159 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8030) AUTHORS Wu Z. TITLE Single large serine recombinase mediates the horizontal transfer of SCCmec in staphylococci JOURNAL Unpublished REFERENCE 2 (bases 1 to 8030) AUTHORS Wu Z. TITLE Direct Submission REFERENCE 3 (bases 1 to 8030) TITLE Direct Submission REFERENCE 4 (bases 1 to 8030) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-FEB-2017) College of Animal Science " SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8030 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(194..782) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(956..1813) /label="AmpR" /note="beta-lactamase" promoter complement(1814..1918) /label="AmpR promoter" primer_bind 2392..2408 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS 3456..4055 /codon_start=1 /product="RepC" /label="RepC" /note="repC; temperature sensitive replicon" /protein_id="ASN64775.1" /translation="MSENVIKETENKKNSRGRNWTFVLYPESAKAEWLEYLKELHIQFV VSPLHDRDTDTEDRMKKEHYHILVMYEGNKSYEQIKIITEELNATIPQIAGSVKGLVRY MLHMDDPNKFKYQKEDMIVYGGVDVDELLKKTTTDRYKLIKEMIEFIDEQGIVEFKSLM DYAMKFKFDDWFPLLCDNSAYVIQEYIKSNRYKSDR" CDS complement(4391..5014) /label="TetR" /note="tetracycline repressor TetR" protein_bind 5036..5054 /label="tet operator" /note="bacterial operator O1 for the tetR and tetA genes" protein_bind 5121..5139 /label="tet operator" /bound_moiety="tetracycline repressor TetR" /note="bacterial operator O1 for the tetR and tetA genes" misc_feature complement(5144..5716) /label="antisense-secY" /note="antisense-secY" CDS 6410..7057 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" misc_feature 7240..7283 /label="MCS" /note="MCS" CDS 7532..7930 /codon_start=1 /product="bleomycin resistance protein" /label="bleomycin resistance protein" /note="bleoR" /protein_id="ASN64778.1" /translation="MLQSIPALPVGDIKKSIGFYCDKLGFTLVHHEDGFAVLMCNEVRI HLWEASDEGWRSRSNDSPVCTGAESFIAGTASCRIEVEGIDELYQHIKPLGILHPNTSL KDQWWDERDFAVIDPDNNLISFFQQIKS"
This page is informational only.