pKU1021fps vector (V005168)

Download GeneBank File(.gb)

LOCUS       40924_27099        7254 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pKU1021fps DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7254)
  AUTHORS   Yamada Y, Kuzuyama T, Komatsu M, Shin-Ya K, Omura S, Cane DE, Ikeda 
            H.
  TITLE     Terpene synthases are widely distributed in bacteria
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 112 (3), 857-862 (2015)
  PUBMED    25535391
REFERENCE   2  (bases 1 to 7254)
  AUTHORS   Ikeda H.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-AUG-2014) Contact:Haruo Ikeda Kitasato University, 
            Kitasato Institute for Life Sciences; 1-15-1 Kitasato, Sagamihara, 
            Kanagawa 252-0373, Japan URL :http://avermitilis.ls.kitasato-u.ac.jp
REFERENCE   3  (bases 1 to 7254)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7254)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
            Acad. Sci. U.S.A."; date: "2015"; volume: "112"; issue: "3"; pages: 
            "857-862"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (12-AUG-2014) Contact:Haruo Ikeda Kitasato University, Kitasato 
            Institute for Life Sciences"; volume: " 1-15-1 Kitasato, Sagamihara,
            Kanagawa 252-0373, Japan URL :http"; pages: 
            "//avermitilis.ls.kitasato-u.ac.j"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7254
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             353..1144
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     oriT            complement(1485..1594)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     CDS             complement(1648..1659)
                     /label=Factor Xa site
                     /note="Factor Xa recognition and cleavage site"
     protein_bind    1730..1829
                     /label=phage phi-C31 attP
                     /note="attachment site of phage phi-C31"
     CDS             1839..3653
                     /label=phage phi-C31 integrase
                     /note="integrase from phage phi-C31"
     rep_origin      3876..4464
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    4752..4773
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        4788..4818
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    4826..4842
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     4850..4866
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(4909..5922)
                     /codon_start=1
                     /gene="ptlB"
                     /product="farnesyl diphosphate synthase"
                     /label=ptlB
                     /note="from Streptomyces avermitilis"
                     /protein_id="BAP82237.1"
                     /translation="MTVTPESLHRSRDAITPALRTALHLLDEETRHQAAYHLGWIEADG
                     TPADGGGGKAVRPALALLSAQAAGAPAETGLPGAVAVELVHNFSLLHDDLMDGDEERRH
                     RRTVWTLWGASGAILTGDALLALAQEVLLDCGLPTGAAAARLLARTTRDLIRGQVQDVA
                     FERRAHVPIEECVDMAAGKTGALLSASAAIGAVLAGAPVTTVDALALYGQQVGLAFQLT
                     DDVLGIWGDPAVTGKSVHSDLRARKKSLPVTYALNQGGTVSVELATWLSAPGEPDEAEL
                     RRAADLVAAAGGRDWATAEAARRMALGEAALRGVDLDAAARDELIALGHFVVDREV"
     gene            complement(4909..5922)
                     /gene="ptlB"
                     /label=ptlB
     regulatory      complement(5926..6472)
                     /gene="rpsJp"
                     /note="promoter of gene encoding ribosomal protein S10;
                     from Streptomyces avermitilis MA-4680"
                     /regulatory_class="promoter"
     gene            complement(5926..6472)
                     /gene="rpsJp"
                     /label=rpsJp
     promoter        6477..6505
                     /gene="intI1 (promoter lies within the coding sequence)"
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     CDS             6694..7224
                     /label=GmR
                     /note="gentamycin acetyltransferase"