pBC SK(-) vector (V012548)

Basic Vector Information

Vector Name:
pBC SK(-)
Antibiotic Resistance:
Chloramphenicol
Length:
3400 bp
Type:
Cloning Vectors
Replication origin:
ori
Source/Author:
Agilent Technologies
Copy Number:
High copy number
5' Primer:
M13 fwd
3' Primer:
M13 rev

pBC SK(-) vector Vector Map

pBC SK(-)3400 bp6001200180024003000f1 oriM13 fwdT7 promoterMCST3 promoterM13 revlac operatorlac promoterCAP binding siteoricat promoterCmRAmpR promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pBC SK(-) vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_6112        3400 bp DNA     circular SYN 01-JAN-1980
DEFINITION  Phagemid vector derived from pBluescript II SK(–), with a 
            chloramphenicol resistance gene. The MCS is reversed relative to pBC
            KS(–).
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3400)
  AUTHORS   Agilent Technologies
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 3400)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3400
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      4..459
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     600..616
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        626..644
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    complement(653..760)
                     /label=MCS
                     /note="pBluescript multiple cloning site"
     promoter        complement(773..791)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(812..828)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(836..852)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(860..890)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(905..926)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(1214..1802)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     promoter        2022..2124
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             2125..2781
                     /codon_start=1
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(3272..3377)
                     /label=AmpR promoter

This page is informational only.