Basic Vector Information
- Vector Name:
- pBC SK(-)
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3400 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- Agilent Technologies
- Copy Number:
- High copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pBC SK(-) vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pBC SK(-) vector Sequence
LOCUS 40924_6112 3400 bp DNA circular SYN 01-JAN-1980 DEFINITION Phagemid vector derived from pBluescript II SK(–), with a chloramphenicol resistance gene. The MCS is reversed relative to pBC KS(–). ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3400) AUTHORS Agilent Technologies TITLE Direct Submission REFERENCE 2 (bases 1 to 3400) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..3400 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 4..459 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 600..616 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 626..644 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(653..760) /label=MCS /note="pBluescript multiple cloning site" promoter complement(773..791) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(812..828) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(836..852) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(860..890) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(905..926) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1214..1802) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 2022..2124 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 2125..2781 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(3272..3377) /label=AmpR promoter
This page is informational only.