Basic Vector Information
- Vector Name:
- pFN2K (GST)
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4132 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- Promega
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
pFN2K (GST) vector Map
pFN2K (GST) vector Sequence
LOCUS 40924_20391 4132 bp DNA circular SYN 01-JAN-1980 DEFINITION Flexi(R) vector with a kanamycin resistance marker, for bacterial or in vitro expression of a protein with a cleavable N-terminal GST tag. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4132) AUTHORS Promega TITLE Direct Submission REFERENCE 2 (bases 1 to 4132) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Subclone a coding sequence between the SgfI/AsiSI and PmeI sites to remove the lethal barnase gene. FEATURES Location/Qualifiers source 1..4132 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 21..39 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 70..723 /codon_start=1 /label=GST /note="glutathione S-transferase from Schistosoma japonicum" /translation="MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKK FELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRY GVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVL YMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK" CDS 742..762 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="ENLYFQA" CDS 791..1123 /codon_start=1 /label=barnase /note="ribonuclease from Bacillus amyloliquefaciens" /translation="MAQVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLAD VAPGKSIGGDIFSNREGKLQGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHY QTFTKIR" misc_feature 1136..1191 /label=MCS /note="pUC18/19 multiple cloning site" terminator 1255..1302 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS 1683..2474 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" /translation="MLEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" rep_origin complement(2649..3237) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 3353..3636 /label=cer region /note="ColE1-derived recombination site that helps to maintain plasmids as monomers" terminator 3866..3952 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 4044..4071 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene"
This page is informational only.