Basic Vector Information
- Vector Name:
- pHSG299
- Antibiotic Resistance:
- Kanamycin
- Length:
- 2673 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- Takeshita S, Sato M, Toba M, Masahashi W, Hashimoto-Gotoh T.
- Copy Number:
- High copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pHSG299 vector Map
pHSG299 vector Sequence
LOCUS 40924_25071 2673 bp DNA circular SYN 01-JAN-1980 DEFINITION pUC-type bacterial cloning vector with a kanamycin resistance gene. The MCS is reversed in pHSG298. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2673) AUTHORS Takeshita S, Sato M, Toba M, Masahashi W, Hashimoto-Gotoh T. TITLE High-copy-number and low-copy-number plasmid vectors for lacZ alpha-complementation and chloramphenicol- or kanamycin-resistance selection. JOURNAL Gene 1987;61:63-74. PUBMED 3327753 REFERENCE 2 (bases 1 to 2673) AUTHORS TaKaRa TITLE Direct Submission REFERENCE 3 (bases 1 to 2673) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; date: "1987"; volume: "61"; pages: "63-74" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..2673 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 327..1139 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSKPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" primer_bind 1361..1377 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 1378..1434 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(1447..1463) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1471..1487) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1495..1525) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1540..1561) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2032..2620) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.