Basic Vector Information
- Vector Name:
- pKF 19k-2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 2204 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- Hashimoto-Gotoh T, Yasojima K, Tsujimura A.
- Copy Number:
- High copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 fwd
pKF 19k-2 vector Map
pKF 19k-2 vector Sequence
LOCUS pKF_19k-2. 2204 bp DNA circular SYN 01-JAN-1980 DEFINITION Bacterial cloning and site-directed mutagenesis vector with a kanamycin resistance gene containing amber stop codons. The MCS is reversed in pKF 18k-2. ACCESSION . VERSION . KEYWORDS pKF 19k-2 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2204) AUTHORS Hashimoto-Gotoh T, Yasojima K, Tsujimura A. TITLE Plasmids with a kanamycin-resistance gene for site-directed mutagenesis using the oligodeoxyribonucleotide-directed dual amber method. JOURNAL Gene 1995;167:333-4. PUBMED 8566803 REFERENCE 2 (bases 1 to 2204) AUTHORS TaKaRa TITLE Direct Submission REFERENCE 3 (bases 1 to 2204) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; date: "1995"; volume: "167"; pages: "333-4" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..2204 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(18..74) /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(75..91) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(310..1125) /codon_start=1 /gene="aph(3')-Ia" /product="aminoglycoside phosphotransferase" /label=aph(3')-Ia /note="KanR (with amber stop codons)" /note="confers resistance to kanamycin in bacteria or G418 (Geneticin(R)) in eukaryotes" /translation="MSHIQRETSCSKPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLA*A*SRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1450..2038 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 2095..2116 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2131..2161 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2169..2185 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.