Basic Vector Information
- Vector Name:
- pMAL-c5X-His
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5695 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- Riggs P.
- Copy Number:
- High copy number
pMAL-c5X-His vector Map
pMAL-c5X-His vector Sequence
LOCUS 40924_29726 5695 bp DNA circular SYN 01-JAN-1980 DEFINITION Bacterial vector for inducible cytoplasmic expression of maltose-binding protein (MBP) fusions with a Factor Xa cleavage site and a C-terminal 6xHis tag. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5695) AUTHORS Riggs P. TITLE Expression and purification of maltose-binding protein fusions. JOURNAL Curr Protoc Mol Biol 2001;Chapter 16:Unit16.6. PUBMED 18265133 REFERENCE 2 (bases 1 to 5695) AUTHORS New England Biolabs TITLE Direct Submission REFERENCE 3 (bases 1 to 5695) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Curr Protoc Mol Biol"; date: "2001"; volume: "Chapter 16"; pages: "Unit16.6" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..5695 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 3..80 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 81..1160 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 1176..1197 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1406..1434 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 1442..1458 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 1528..2628 /codon_start=1 /label=MBP /note="maltose binding protein from E. coli" /translation="MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLE EKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKL IAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIA ADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGE TAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFL ENYLLTDEGLEAVNKDKPLGAVALKSYEEELVKDPRIAATMENAQKGEIMPNIPQMSAF WYAVRTAVINAASGRQTVDEALKDAQT" CDS 2677..2688 /codon_start=1 /label=Factor Xa site /note="Factor Xa recognition and cleavage site" /translation="IEGR" CDS 2752..2769 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 2781..2867 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2959..2986 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 3013..3104 /label=AmpR promoter CDS 3105..3962 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 4053..4641 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5014..5202) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL"
This page is informational only.