Basic Vector Information
- Vector Name:
- pMiniT
- Antibiotic Resistance:
- Ampicillin
- Length:
- 2525 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- New England Biolabs
- Copy Number:
- High copy number
pMiniT vector Map
pMiniT vector Sequence
LOCUS pMiniT. 2525 bp DNA circular SYN 01-JAN-1980 DEFINITION Compact bacterial vector that employs a toxic minigene for high-efficiency cloning of PCR products. ACCESSION . VERSION . KEYWORDS pMiniT SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2525) AUTHORS New England Biolabs TITLE Direct Submission REFERENCE 2 (bases 1 to 2525) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..2525 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 145..251 /gene="tnpA" /label=tnpA promoter /note="tnpA promoter" /note="promoter of the IS10 transposase" CDS 252..482 /codon_start=1 /product="transposase encoded by the IS10 tnpA gene" /label=transposase encoded by the IS10 tnpA gene /note="tnpA transposase" /translation="MCELDILHDSLYQFCPELHLKRLNSLTLACHALLDCKTLTLTELG RNLPTKARTKHNIKRIDRLLGNRHLHKERLAV" RBS 504..510 /label=Shine-Dalgarno sequence /note="Shine-Dalgarno sequence" /note="ribosome binding site" CDS 518..523 /codon_start=1 /product="two-residue polypeptide that poisons the E. coli translation machinery" /label=two-residue polypeptide that poisons the E. col /note="toxic minigene" /translation="MI" misc_feature 524..535 /label=stop codons /note="stop codons" promoter 565..669 /label=AmpR promoter CDS 670..1527 /label=AmpR /note="beta-lactamase" rep_origin 1701..2289 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.