Basic Vector Information
- Vector Name:
- pPCR-Script Cam SK(+)
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3400 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- Agilent Technologies
- Copy Number:
- High copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pPCR-Script Cam SK(+) vector Vector Map
pPCR-Script Cam SK(+) vector Sequence
LOCUS 40924_34156 3400 bp DNA circular SYN 01-JAN-1980 DEFINITION Bacterial cloning vector with a chloramphenicol resistance marker and an SrfI site for inserting blunt PCR products. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3400) AUTHORS Agilent Technologies TITLE Direct Submission REFERENCE 2 (bases 1 to 3400) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..3400 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(3..458) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 600..616 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 626..644 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(653..760) /label=MCS /note="pBluescript multiple cloning site" promoter complement(773..791) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(812..828) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(836..852) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(860..890) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(905..926) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1214..1802) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 2022..2124 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 2125..2781 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(3272..3377) /label=AmpR promoter
This page is informational only.