Basic Vector Information
- Vector Name:
- pSTV29
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 2999 bp
- Type:
- Cloning Vectors
- Replication origin:
- p15A ori
- Source/Author:
- TaKaRa
- Copy Number:
- Medium copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pSTV29 vector Vector Map
pSTV29 vector Sequence
LOCUS 40924_41380 2999 bp DNA circular SYN 01-JAN-1980 DEFINITION Bacterial cloning vector with a p15A origin and a chloramphenicol resistance gene. The MCS is reversed in pSTV28. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2999) AUTHORS TaKaRa TITLE Direct Submission REFERENCE 2 (bases 1 to 2999) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..2999 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(220..322) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(848..1392) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." primer_bind 1667..1683 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 1684..1740 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(1753..1769) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1777..1793) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1801..1831) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1846..1867) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(join(2562..2999,1..219)) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
This page is informational only.