Basic Vector Information
- Vector Name:
- pSTV29
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 2999 bp
- Type:
- Cloning Vectors
- Replication origin:
- p15A ori
- Source/Author:
- TaKaRa
- Copy Number:
- Medium copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pSTV29 vector Map
pSTV29 vector Sequence
LOCUS 40924_41380 2999 bp DNA circular SYN 01-JAN-1980
DEFINITION Bacterial cloning vector with a p15A origin and a chloramphenicol
resistance gene. The MCS is reversed in pSTV28.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 2999)
AUTHORS TaKaRa
TITLE Direct Submission
REFERENCE 2 (bases 1 to 2999)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..2999
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter complement(220..322)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
rep_origin complement(848..1392)
/direction=LEFT
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
primer_bind 1667..1683
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 1684..1740
/label=MCS
/note="pUC18/19 multiple cloning site"
primer_bind complement(1753..1769)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(1777..1793)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(1801..1831)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(1846..1867)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
CDS complement(join(2562..2999,1..219))
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
This page is informational only.