Basic Vector Information
- Vector Name:
- pDsRed-Express2-1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4107 bp
- Type:
- Fluorescent Protein Genes & Plasmids
- Replication origin:
- ori
- Source/Author:
- Clontech
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
pDsRed-Express2-1 vector Vector Map
pDsRed-Express2-1 vector Sequence
LOCUS 40924_15635 4107 bp DNA circular SYN 01-JAN-1980 DEFINITION Promoterless reporter vector encoding rapidly maturing and noncytotoxic DsRed-Express2. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4107) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 4107) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Can be used to monitor transcription from a promoter inserted into the MCS. FEATURES Location/Qualifiers source 1..4107 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 9..89 /label=MCS /note="multiple cloning site" CDS 97..771 /codon_start=1 /label=DsRed-Express2 /note="noncytotoxic tetrameric variant of DsRed fluorescent protein (Strack et al., 2008)" /translation="MDSTENVIKPFMRFKVHMEGSVNGHEFEIEGEGEGKPYEGTQTAK LQVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGV VTVTQDSSLQDGTFIYHVKFIGVNFPSDGPVMQKKTLGWEPSTERLYPRDGVLKGEIHK ALKLKGGGHYLVEFKSIYMAKKPVKLPGYYYVDSKLDITSHNEDYTVVEQYERAEARHH LFQ" polyA_signal 895..1016 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1023..1478) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1505..1609 /label=AmpR promoter promoter 1611..1968 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2003..2794 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3029..3076 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 3405..3993 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.